{"version":3,"file":"bundle.js","sources":["../node_modules/@vue/shared/dist/shared.esm-bundler.js","../node_modules/@vue/reactivity/dist/reactivity.esm-bundler.js","../node_modules/@vue/runtime-core/dist/runtime-core.esm-bundler.js","../node_modules/@vue/runtime-dom/dist/runtime-dom.esm-bundler.js","../node_modules/@vue/compiler-core/dist/compiler-core.esm-bundler.js","../node_modules/@vue/compiler-dom/dist/compiler-dom.esm-bundler.js","../node_modules/vue/dist/vue.esm-bundler.js","../node_modules/tabbable/dist/index.esm.js","../node_modules/focus-trap/dist/focus-trap.esm.js","../node_modules/@vueuse/integrations/useFocusTrap.mjs","../node_modules/vue-final-modal/dist/index.es.mjs","../node_modules/dompurify/dist/purify.es.mjs","../node_modules/vue-dompurify-html/dist/vue-dompurify-html.mjs","../node_modules/picturefill/dist/picturefill.js","../node_modules/lazysizes/lazysizes.js","../node_modules/core-js/modules/_global.js","../node_modules/core-js/modules/_has.js","../node_modules/core-js/modules/_fails.js","../node_modules/core-js/modules/_descriptors.js","../node_modules/core-js/modules/_core.js","../node_modules/core-js/modules/_is-object.js","../node_modules/core-js/modules/_an-object.js","../node_modules/core-js/modules/_dom-create.js","../node_modules/core-js/modules/_ie8-dom-define.js","../node_modules/core-js/modules/_to-primitive.js","../node_modules/core-js/modules/_object-dp.js","../node_modules/core-js/modules/_property-desc.js","../node_modules/core-js/modules/_hide.js","../node_modules/core-js/modules/_uid.js","../node_modules/core-js/modules/_library.js","../node_modules/core-js/modules/_shared.js","../node_modules/core-js/modules/_function-to-string.js","../node_modules/core-js/modules/_redefine.js","../node_modules/core-js/modules/_a-function.js","../node_modules/core-js/modules/_ctx.js","../node_modules/core-js/modules/_export.js","../node_modules/core-js/modules/_meta.js","../node_modules/core-js/modules/_wks.js","../node_modules/core-js/modules/_set-to-string-tag.js","../node_modules/core-js/modules/_wks-ext.js","../node_modules/core-js/modules/_wks-define.js","../node_modules/core-js/modules/_cof.js","../node_modules/core-js/modules/_iobject.js","../node_modules/core-js/modules/_defined.js","../node_modules/core-js/modules/_to-iobject.js","../node_modules/core-js/modules/_to-integer.js","../node_modules/core-js/modules/_to-length.js","../node_modules/core-js/modules/_to-absolute-index.js","../node_modules/core-js/modules/_array-includes.js","../node_modules/core-js/modules/_shared-key.js","../node_modules/core-js/modules/_object-keys-internal.js","../node_modules/core-js/modules/_enum-bug-keys.js","../node_modules/core-js/modules/_object-keys.js","../node_modules/core-js/modules/_object-gops.js","../node_modules/core-js/modules/_object-pie.js","../node_modules/core-js/modules/_enum-keys.js","../node_modules/core-js/modules/_is-array.js","../node_modules/core-js/modules/_to-object.js","../node_modules/core-js/modules/_object-dps.js","../node_modules/core-js/modules/_html.js","../node_modules/core-js/modules/_object-create.js","../node_modules/core-js/modules/_object-gopn.js","../node_modules/core-js/modules/_object-gopn-ext.js","../node_modules/core-js/modules/_object-gopd.js","../node_modules/core-js/modules/es6.symbol.js","../node_modules/core-js/modules/es6.object.create.js","../node_modules/core-js/modules/es6.object.define-property.js","../node_modules/core-js/modules/es6.object.define-properties.js","../node_modules/core-js/modules/_object-sap.js","../node_modules/core-js/modules/es6.object.get-own-property-descriptor.js","../node_modules/core-js/modules/_object-gpo.js","../node_modules/core-js/modules/es6.object.get-prototype-of.js","../node_modules/core-js/modules/es6.object.keys.js","../node_modules/core-js/modules/es6.object.get-own-property-names.js","../node_modules/core-js/modules/es6.object.freeze.js","../node_modules/core-js/modules/es6.object.seal.js","../node_modules/core-js/modules/es6.object.prevent-extensions.js","../node_modules/core-js/modules/es6.object.is-frozen.js","../node_modules/core-js/modules/es6.object.is-sealed.js","../node_modules/core-js/modules/es6.object.is-extensible.js","../node_modules/core-js/modules/_object-assign.js","../node_modules/core-js/modules/es6.object.assign.js","../node_modules/core-js/modules/_same-value.js","../node_modules/core-js/modules/es6.object.is.js","../node_modules/core-js/modules/_set-proto.js","../node_modules/core-js/modules/es6.object.set-prototype-of.js","../node_modules/core-js/modules/_classof.js","../node_modules/core-js/modules/es6.object.to-string.js","../node_modules/core-js/modules/_invoke.js","../node_modules/core-js/modules/_bind.js","../node_modules/core-js/modules/es6.function.bind.js","../node_modules/core-js/modules/es6.function.name.js","../node_modules/core-js/modules/es6.function.has-instance.js","../node_modules/core-js/modules/_string-ws.js","../node_modules/core-js/modules/_string-trim.js","../node_modules/core-js/modules/_parse-int.js","../node_modules/core-js/modules/es6.parse-int.js","../node_modules/core-js/modules/_parse-float.js","../node_modules/core-js/modules/es6.parse-float.js","../node_modules/core-js/modules/_inherit-if-required.js","../node_modules/core-js/modules/es6.number.constructor.js","../node_modules/core-js/modules/_a-number-value.js","../node_modules/core-js/modules/_string-repeat.js","../node_modules/core-js/modules/es6.number.to-fixed.js","../node_modules/core-js/modules/es6.number.to-precision.js","../node_modules/core-js/modules/es6.number.epsilon.js","../node_modules/core-js/modules/es6.number.is-finite.js","../node_modules/core-js/modules/_is-integer.js","../node_modules/core-js/modules/es6.number.is-integer.js","../node_modules/core-js/modules/es6.number.is-nan.js","../node_modules/core-js/modules/es6.number.is-safe-integer.js","../node_modules/core-js/modules/es6.number.max-safe-integer.js","../node_modules/core-js/modules/es6.number.min-safe-integer.js","../node_modules/core-js/modules/es6.number.parse-float.js","../node_modules/core-js/modules/es6.number.parse-int.js","../node_modules/core-js/modules/_math-log1p.js","../node_modules/core-js/modules/es6.math.acosh.js","../node_modules/core-js/modules/es6.math.asinh.js","../node_modules/core-js/modules/es6.math.atanh.js","../node_modules/core-js/modules/_math-sign.js","../node_modules/core-js/modules/es6.math.cbrt.js","../node_modules/core-js/modules/es6.math.clz32.js","../node_modules/core-js/modules/es6.math.cosh.js","../node_modules/core-js/modules/_math-expm1.js","../node_modules/core-js/modules/es6.math.expm1.js","../node_modules/core-js/modules/_math-fround.js","../node_modules/core-js/modules/es6.math.fround.js","../node_modules/core-js/modules/es6.math.hypot.js","../node_modules/core-js/modules/es6.math.imul.js","../node_modules/core-js/modules/es6.math.log10.js","../node_modules/core-js/modules/es6.math.log1p.js","../node_modules/core-js/modules/es6.math.log2.js","../node_modules/core-js/modules/es6.math.sign.js","../node_modules/core-js/modules/es6.math.sinh.js","../node_modules/core-js/modules/es6.math.tanh.js","../node_modules/core-js/modules/es6.math.trunc.js","../node_modules/core-js/modules/es6.string.from-code-point.js","../node_modules/core-js/modules/es6.string.raw.js","../node_modules/core-js/modules/es6.string.trim.js","../node_modules/core-js/modules/_string-at.js","../node_modules/core-js/modules/_iterators.js","../node_modules/core-js/modules/_iter-create.js","../node_modules/core-js/modules/_iter-define.js","../node_modules/core-js/modules/es6.string.iterator.js","../node_modules/core-js/modules/es6.string.code-point-at.js","../node_modules/core-js/modules/_is-regexp.js","../node_modules/core-js/modules/_string-context.js","../node_modules/core-js/modules/_fails-is-regexp.js","../node_modules/core-js/modules/es6.string.ends-with.js","../node_modules/core-js/modules/es6.string.includes.js","../node_modules/core-js/modules/es6.string.repeat.js","../node_modules/core-js/modules/es6.string.starts-with.js","../node_modules/core-js/modules/_string-html.js","../node_modules/core-js/modules/es6.string.anchor.js","../node_modules/core-js/modules/es6.string.big.js","../node_modules/core-js/modules/es6.string.blink.js","../node_modules/core-js/modules/es6.string.bold.js","../node_modules/core-js/modules/es6.string.fixed.js","../node_modules/core-js/modules/es6.string.fontcolor.js","../node_modules/core-js/modules/es6.string.fontsize.js","../node_modules/core-js/modules/es6.string.italics.js","../node_modules/core-js/modules/es6.string.link.js","../node_modules/core-js/modules/es6.string.small.js","../node_modules/core-js/modules/es6.string.strike.js","../node_modules/core-js/modules/es6.string.sub.js","../node_modules/core-js/modules/es6.string.sup.js","../node_modules/core-js/modules/es6.date.now.js","../node_modules/core-js/modules/es6.date.to-json.js","../node_modules/core-js/modules/_date-to-iso-string.js","../node_modules/core-js/modules/es6.date.to-iso-string.js","../node_modules/core-js/modules/es6.date.to-string.js","../node_modules/core-js/modules/_date-to-primitive.js","../node_modules/core-js/modules/es6.date.to-primitive.js","../node_modules/core-js/modules/es6.array.is-array.js","../node_modules/core-js/modules/_iter-call.js","../node_modules/core-js/modules/_is-array-iter.js","../node_modules/core-js/modules/_create-property.js","../node_modules/core-js/modules/core.get-iterator-method.js","../node_modules/core-js/modules/_iter-detect.js","../node_modules/core-js/modules/es6.array.from.js","../node_modules/core-js/modules/es6.array.of.js","../node_modules/core-js/modules/_strict-method.js","../node_modules/core-js/modules/es6.array.join.js","../node_modules/core-js/modules/es6.array.slice.js","../node_modules/core-js/modules/es6.array.sort.js","../node_modules/core-js/modules/_array-species-constructor.js","../node_modules/core-js/modules/_array-species-create.js","../node_modules/core-js/modules/_array-methods.js","../node_modules/core-js/modules/es6.array.for-each.js","../node_modules/core-js/modules/es6.array.map.js","../node_modules/core-js/modules/es6.array.filter.js","../node_modules/core-js/modules/es6.array.some.js","../node_modules/core-js/modules/es6.array.every.js","../node_modules/core-js/modules/_array-reduce.js","../node_modules/core-js/modules/es6.array.reduce.js","../node_modules/core-js/modules/es6.array.reduce-right.js","../node_modules/core-js/modules/es6.array.index-of.js","../node_modules/core-js/modules/es6.array.last-index-of.js","../node_modules/core-js/modules/_array-copy-within.js","../node_modules/core-js/modules/_add-to-unscopables.js","../node_modules/core-js/modules/es6.array.copy-within.js","../node_modules/core-js/modules/_array-fill.js","../node_modules/core-js/modules/es6.array.fill.js","../node_modules/core-js/modules/es6.array.find.js","../node_modules/core-js/modules/es6.array.find-index.js","../node_modules/core-js/modules/_set-species.js","../node_modules/core-js/modules/es6.array.species.js","../node_modules/core-js/modules/_iter-step.js","../node_modules/core-js/modules/es6.array.iterator.js","../node_modules/core-js/modules/_flags.js","../node_modules/core-js/modules/es6.regexp.constructor.js","../node_modules/core-js/modules/_regexp-exec.js","../node_modules/core-js/modules/es6.regexp.exec.js","../node_modules/core-js/modules/es6.regexp.flags.js","../node_modules/core-js/modules/es6.regexp.to-string.js","../node_modules/core-js/modules/_advance-string-index.js","../node_modules/core-js/modules/_regexp-exec-abstract.js","../node_modules/core-js/modules/_fix-re-wks.js","../node_modules/core-js/modules/es6.regexp.match.js","../node_modules/core-js/modules/es6.regexp.replace.js","../node_modules/core-js/modules/es6.regexp.search.js","../node_modules/core-js/modules/_species-constructor.js","../node_modules/core-js/modules/es6.regexp.split.js","../node_modules/core-js/modules/_an-instance.js","../node_modules/core-js/modules/_for-of.js","../node_modules/core-js/modules/_task.js","../node_modules/core-js/modules/_microtask.js","../node_modules/core-js/modules/_new-promise-capability.js","../node_modules/core-js/modules/_perform.js","../node_modules/core-js/modules/_user-agent.js","../node_modules/core-js/modules/_promise-resolve.js","../node_modules/core-js/modules/_redefine-all.js","../node_modules/core-js/modules/es6.promise.js","../node_modules/core-js/modules/_validate-collection.js","../node_modules/core-js/modules/_collection-strong.js","../node_modules/core-js/modules/_collection.js","../node_modules/core-js/modules/es6.map.js","../node_modules/core-js/modules/es6.set.js","../node_modules/core-js/modules/_collection-weak.js","../node_modules/core-js/modules/es6.weak-map.js","../node_modules/core-js/modules/es6.weak-set.js","../node_modules/core-js/modules/_typed.js","../node_modules/core-js/modules/_to-index.js","../node_modules/core-js/modules/_typed-buffer.js","../node_modules/core-js/modules/es6.typed.array-buffer.js","../node_modules/core-js/modules/es6.typed.data-view.js","../node_modules/core-js/modules/_typed-array.js","../node_modules/core-js/modules/es6.typed.int8-array.js","../node_modules/core-js/modules/es6.typed.uint8-array.js","../node_modules/core-js/modules/es6.typed.uint8-clamped-array.js","../node_modules/core-js/modules/es6.typed.int16-array.js","../node_modules/core-js/modules/es6.typed.uint16-array.js","../node_modules/core-js/modules/es6.typed.int32-array.js","../node_modules/core-js/modules/es6.typed.uint32-array.js","../node_modules/core-js/modules/es6.typed.float32-array.js","../node_modules/core-js/modules/es6.typed.float64-array.js","../node_modules/core-js/modules/es6.reflect.apply.js","../node_modules/core-js/modules/es6.reflect.construct.js","../node_modules/core-js/modules/es6.reflect.define-property.js","../node_modules/core-js/modules/es6.reflect.delete-property.js","../node_modules/core-js/modules/es6.reflect.enumerate.js","../node_modules/core-js/modules/es6.reflect.get.js","../node_modules/core-js/modules/es6.reflect.get-own-property-descriptor.js","../node_modules/core-js/modules/es6.reflect.get-prototype-of.js","../node_modules/core-js/modules/es6.reflect.has.js","../node_modules/core-js/modules/es6.reflect.is-extensible.js","../node_modules/core-js/modules/_own-keys.js","../node_modules/core-js/modules/es6.reflect.own-keys.js","../node_modules/core-js/modules/es6.reflect.prevent-extensions.js","../node_modules/core-js/modules/es6.reflect.set.js","../node_modules/core-js/modules/es6.reflect.set-prototype-of.js","../node_modules/core-js/modules/es7.array.includes.js","../node_modules/core-js/modules/_flatten-into-array.js","../node_modules/core-js/modules/es7.array.flat-map.js","../node_modules/core-js/modules/es7.array.flatten.js","../node_modules/core-js/modules/es7.string.at.js","../node_modules/core-js/modules/_string-pad.js","../node_modules/core-js/modules/es7.string.pad-start.js","../node_modules/core-js/modules/es7.string.pad-end.js","../node_modules/core-js/modules/es7.string.trim-left.js","../node_modules/core-js/modules/es7.string.trim-right.js","../node_modules/core-js/modules/es7.string.match-all.js","../node_modules/core-js/modules/es7.symbol.async-iterator.js","../node_modules/core-js/modules/es7.symbol.observable.js","../node_modules/core-js/modules/es7.object.get-own-property-descriptors.js","../node_modules/core-js/modules/_object-to-array.js","../node_modules/core-js/modules/es7.object.values.js","../node_modules/core-js/modules/es7.object.entries.js","../node_modules/core-js/modules/_object-forced-pam.js","../node_modules/core-js/modules/es7.object.define-getter.js","../node_modules/core-js/modules/es7.object.define-setter.js","../node_modules/core-js/modules/es7.object.lookup-getter.js","../node_modules/core-js/modules/es7.object.lookup-setter.js","../node_modules/core-js/modules/_array-from-iterable.js","../node_modules/core-js/modules/_collection-to-json.js","../node_modules/core-js/modules/es7.map.to-json.js","../node_modules/core-js/modules/es7.set.to-json.js","../node_modules/core-js/modules/_set-collection-of.js","../node_modules/core-js/modules/es7.map.of.js","../node_modules/core-js/modules/es7.set.of.js","../node_modules/core-js/modules/es7.weak-map.of.js","../node_modules/core-js/modules/es7.weak-set.of.js","../node_modules/core-js/modules/_set-collection-from.js","../node_modules/core-js/modules/es7.map.from.js","../node_modules/core-js/modules/es7.set.from.js","../node_modules/core-js/modules/es7.weak-map.from.js","../node_modules/core-js/modules/es7.weak-set.from.js","../node_modules/core-js/modules/es7.global.js","../node_modules/core-js/modules/es7.system.global.js","../node_modules/core-js/modules/es7.error.is-error.js","../node_modules/core-js/modules/es7.math.clamp.js","../node_modules/core-js/modules/es7.math.deg-per-rad.js","../node_modules/core-js/modules/es7.math.degrees.js","../node_modules/core-js/modules/_math-scale.js","../node_modules/core-js/modules/es7.math.fscale.js","../node_modules/core-js/modules/es7.math.iaddh.js","../node_modules/core-js/modules/es7.math.isubh.js","../node_modules/core-js/modules/es7.math.imulh.js","../node_modules/core-js/modules/es7.math.rad-per-deg.js","../node_modules/core-js/modules/es7.math.radians.js","../node_modules/core-js/modules/es7.math.scale.js","../node_modules/core-js/modules/es7.math.umulh.js","../node_modules/core-js/modules/es7.math.signbit.js","../node_modules/core-js/modules/es7.promise.finally.js","../node_modules/core-js/modules/es7.promise.try.js","../node_modules/core-js/modules/_metadata.js","../node_modules/core-js/modules/es7.reflect.define-metadata.js","../node_modules/core-js/modules/es7.reflect.delete-metadata.js","../node_modules/core-js/modules/es7.reflect.get-metadata.js","../node_modules/core-js/modules/es7.reflect.get-metadata-keys.js","../node_modules/core-js/modules/es7.reflect.get-own-metadata.js","../node_modules/core-js/modules/es7.reflect.get-own-metadata-keys.js","../node_modules/core-js/modules/es7.reflect.has-metadata.js","../node_modules/core-js/modules/es7.reflect.has-own-metadata.js","../node_modules/core-js/modules/es7.reflect.metadata.js","../node_modules/core-js/modules/es7.asap.js","../node_modules/core-js/modules/es7.observable.js","../node_modules/core-js/modules/web.timers.js","../node_modules/core-js/modules/web.immediate.js","../node_modules/core-js/modules/web.dom.iterable.js","../node_modules/regenerator-runtime/runtime.js","../node_modules/core-js/modules/_replacer.js","../node_modules/core-js/modules/core.regexp.escape.js","../node_modules/babel-polyfill/lib/index.js","../node_modules/core-js/fn/regexp/escape.js","../node_modules/element-closest-polyfill/index.js","../node_modules/dom7/node_modules/ssr-window/dist/ssr-window.esm.js","../node_modules/dom7/dist/dom7.modular.js","../node_modules/ssr-window/dist/ssr-window.esm.js","../node_modules/swiper/dist/js/swiper.esm.bundle.js","../node_modules/lodash/isObject.js","../node_modules/lodash/_freeGlobal.js","../node_modules/lodash/_root.js","../node_modules/lodash/now.js","../node_modules/lodash/_trimmedEndIndex.js","../node_modules/lodash/_baseTrim.js","../node_modules/lodash/_Symbol.js","../node_modules/lodash/_getRawTag.js","../node_modules/lodash/_objectToString.js","../node_modules/lodash/_baseGetTag.js","../node_modules/lodash/isObjectLike.js","../node_modules/lodash/isSymbol.js","../node_modules/lodash/toNumber.js","../node_modules/lodash/debounce.js","../node_modules/lodash/_arrayEach.js","../node_modules/lodash/_createBaseFor.js","../node_modules/lodash/_baseFor.js","../node_modules/lodash/_baseTimes.js","../node_modules/lodash/_baseIsArguments.js","../node_modules/lodash/isArguments.js","../node_modules/lodash/isArray.js","../node_modules/lodash/stubFalse.js","../node_modules/lodash/isBuffer.js","../node_modules/lodash/_isIndex.js","../node_modules/lodash/isLength.js","../node_modules/lodash/_baseIsTypedArray.js","../node_modules/lodash/_baseUnary.js","../node_modules/lodash/_nodeUtil.js","../node_modules/lodash/isTypedArray.js","../node_modules/lodash/_arrayLikeKeys.js","../node_modules/lodash/_isPrototype.js","../node_modules/lodash/_overArg.js","../node_modules/lodash/_nativeKeys.js","../node_modules/lodash/_baseKeys.js","../node_modules/lodash/isFunction.js","../node_modules/lodash/isArrayLike.js","../node_modules/lodash/keys.js","../node_modules/lodash/_baseForOwn.js","../node_modules/lodash/_createBaseEach.js","../node_modules/lodash/_baseEach.js","../node_modules/lodash/identity.js","../node_modules/lodash/_castFunction.js","../node_modules/lodash/forEach.js","../src/niobium/scripts/plain/tabs.js","../src/niobium/scripts/plain/accordion.js","../node_modules/url-search-params-polyfill/index.js","../src/niobium/scripts/utils/utils.js","../src/niobium/scripts/plain/safety-datasheet.js","../src/niobium/scripts/plain/menu-open.js","../src/niobium/scripts/plain/searchMenu.js","../src/niobium/scripts/plain/form.js","../src/niobium/scripts/plain/anchor.js","../src/niobium/scripts/plain/contact.js","../src/niobium/scripts/plain/prevent-scroll.js","../src/niobium/scripts/plain/dropdown.js","../src/niobium/scripts/plain/menu-accessibility.js","../src/niobium/scripts/tagging/tagging.js","../src/niobium/scripts/utils/jsapi-youku.js","../src/niobium/scripts/utils/onetrust-renew.js","../src/niobium/scripts/plugins/ls.unveilhooks.js","../src/niobium/scripts/plugins/lazysizes-bgset.js","../src/niobium/scripts/utils/lazysizes-bg-init.js","../node_modules/vue-social-sharing/dist/vue-social-sharing.js","../node_modules/@hotjar/browser/dist/index.esm.js","../node_modules/vue-masonry-css/dist/vue-masonry.es2015.js","../node_modules/vue-scrollto/vue-scrollto.js","../src/niobium/scripts/plain/generic-slider.js","../src/niobium/scripts/plain/slider.js","../node_modules/@vue/devtools-api/lib/esm/env.js","../node_modules/@vue/devtools-api/lib/esm/const.js","../node_modules/@vue/devtools-api/lib/esm/time.js","../node_modules/@vue/devtools-api/lib/esm/proxy.js","../node_modules/@vue/devtools-api/lib/esm/index.js","../node_modules/vuex/dist/vuex.esm-bundler.js","../src/niobium/scripts/store/app-store.js","../src/niobium/scripts/store/tabs-store.js","../src/niobium/scripts/store/types.js","../node_modules/lodash/lodash.js","../src/niobium/scripts/store/media-library/medialibrary-store-util.js","../node_modules/axios/lib/helpers/bind.js","../node_modules/is-buffer/index.js","../node_modules/axios/lib/utils.js","../node_modules/axios/lib/helpers/normalizeHeaderName.js","../node_modules/axios/lib/core/enhanceError.js","../node_modules/axios/lib/core/createError.js","../node_modules/axios/lib/core/settle.js","../node_modules/axios/lib/helpers/buildURL.js","../node_modules/axios/lib/helpers/parseHeaders.js","../node_modules/axios/lib/helpers/isURLSameOrigin.js","../node_modules/axios/lib/helpers/cookies.js","../node_modules/axios/lib/adapters/xhr.js","../node_modules/axios/lib/defaults.js","../node_modules/axios/lib/core/InterceptorManager.js","../node_modules/axios/lib/core/transformData.js","../node_modules/axios/lib/cancel/isCancel.js","../node_modules/axios/lib/helpers/isAbsoluteURL.js","../node_modules/axios/lib/helpers/combineURLs.js","../node_modules/axios/lib/core/dispatchRequest.js","../node_modules/axios/lib/core/Axios.js","../node_modules/axios/lib/cancel/Cancel.js","../node_modules/axios/lib/cancel/CancelToken.js","../node_modules/axios/lib/helpers/spread.js","../node_modules/axios/lib/axios.js","../node_modules/axios/index.js","../src/niobium/scripts/services/medialibrary.js","../src/niobium/scripts/store/media-library/medialibrary-store.js","../src/niobium/scripts/store/advanced-carousel/advanced-carousel-store.js","../src/niobium/scripts/store/onetrust/onetrust-store.js","../src/niobium/scripts/store/form-store.js","../src/niobium/scripts/store/share-config-store.js","../src/niobium/scripts/store/index.js","../src/niobium/scripts/components/ions/icon/icon.vue","../src/niobium/scripts/components/ions/index.js","../src/niobium/scripts/components/atoms/text/text.vue","../src/niobium/scripts/components/atoms/accordion-item/accordion-item.vue","../src/niobium/scripts/components/atoms/breadcrumb/breadcrumb.vue","../src/niobium/scripts/components/atoms/button/button.vue","../src/niobium/scripts/components/atoms/category-tag/category-tag.vue","../src/niobium/scripts/components/atoms/copy-to-clipboard/copy-to-clipboard.vue","../src/niobium/scripts/components/atoms/disposition/col.vue","../src/niobium/scripts/components/atoms/disposition/ct.vue","../src/niobium/scripts/components/atoms/disposition/row.vue","../src/niobium/scripts/components/atoms/divider/divider.vue","../src/niobium/scripts/components/atoms/gradient/gradient.vue","../src/niobium/scripts/tagging/isOutbound.js","../src/niobium/scripts/components/atoms/image/image.vue","../src/niobium/scripts/components/atoms/kicker/kicker.vue","../src/niobium/scripts/components/atoms/link-item/link-item.vue","../src/niobium/scripts/components/atoms/nt-loading/nt-loading.vue","../src/niobium/scripts/components/atoms/overlay/overlay.vue","../node_modules/tiny-emitter/index.js","../node_modules/tiny-emitter/instance.js","../src/niobium/scripts/emitter.js","../src/niobium/scripts/components/atoms/player/player.vue","../src/niobium/scripts/components/atoms/scroll-to-top/scroll-to-top.vue","../src/niobium/scripts/components/atoms/social-media-icons/social-media-icons.vue","../src/niobium/scripts/components/atoms/title/title.vue","../node_modules/gsap/gsap-core.js","../node_modules/gsap/CSSPlugin.js","../node_modules/gsap/index.js","../src/niobium/scripts/components/atoms/topic/topic.vue","../src/niobium/scripts/components/atoms/text-with-icon/text-with-icon.vue","../src/niobium/scripts/components/atoms/index.js","../src/niobium/scripts/components/molecules/accordion/accordion.vue","../src/niobium/scripts/components/molecules/card-news/card-news.vue","../src/niobium/scripts/components/molecules/heading/heading.vue","../src/niobium/scripts/components/molecules/headquarter-item/headquarter-item.vue","../src/niobium/scripts/components/molecules/link-list/link-list.vue","../src/niobium/scripts/components/molecules/nt-dropdown/nt-dropdown.vue","../src/niobium/scripts/components/molecules/nt-form-fields/nt-form-checkgroup/form-check.vue","../src/niobium/scripts/components/molecules/nt-form-fields/nt-form-checkgroup/nt-form-checkgroup.vue","../src/niobium/scripts/components/molecules/nt-form-fields/nt-form-checklink/nt-form-checklink.vue","../src/niobium/scripts/components/molecules/nt-form-fields/nt-form-customresult/nt-form-customresult.vue","../src/niobium/scripts/components/molecules/nt-form-fields/nt-form-input/nt-form-input.vue","../src/niobium/scripts/components/molecules/nt-form-fields/nt-form-radiogroup/nt-form-radio.vue","../src/niobium/scripts/components/molecules/nt-form-fields/nt-form-select-2/nt-form-select-2.vue","../src/niobium/scripts/components/molecules/nt-form-fields/nt-form-radiogroup/nt-form-radiogroup.vue","../src/niobium/scripts/components/molecules/nt-form-fields/nt-form-richtext/nt-form-richtext.vue","../src/niobium/scripts/components/molecules/nt-form-fields/nt-form-submit/nt-form-submit.vue","../src/niobium/scripts/components/molecules/nt-form-fields/nt-form-textarea/form-textarea.vue","../src/niobium/scripts/components/molecules/nt-form-fields/nt-form-uploader/uploader-file.vue","../src/niobium/scripts/components/molecules/nt-form-fields/nt-form-uploader/uploader.vue","../src/niobium/scripts/components/molecules/nt-quote/nt-quote.vue","../src/niobium/scripts/components/molecules/onetrust/onetrust.vue","../src/niobium/scripts/components/molecules/onetrust/onetrust-blocker.vue","../src/niobium/scripts/components/molecules/paginator/paginator.vue","../src/niobium/scripts/components/molecules/press/press-item.vue","../src/niobium/scripts/components/molecules/press/api.js","../src/niobium/scripts/components/molecules/press/press.vue","../src/niobium/scripts/components/molecules/press/index.js","../src/niobium/scripts/components/molecules/safety-datasheet-v2/safety-drop.vue","../src/niobium/scripts/components/molecules/safety-datasheet-v2/safety-file.vue","../src/niobium/scripts/components/molecules/safety-datasheet-v2/safety-datasheet-v2.vue","../src/niobium/scripts/components/molecules/search-input/search-input.vue","../src/niobium/scripts/components/molecules/share-overlay/share-overlay.vue","../src/niobium/scripts/components/molecules/share-this/share-this.vue","../src/niobium/scripts/components/molecules/smart-card/smart-card.vue","../src/niobium/scripts/components/molecules/index.js","../src/niobium/scripts/components/organisms/advanced-banner/advanced-banner.vue","../src/niobium/scripts/components/organisms/advanced-carousel/advanced-carousel.vue","../src/niobium/scripts/components/organisms/advanced-search/api.js","../node_modules/lodash/_coreJsData.js","../node_modules/lodash/_isMasked.js","../node_modules/lodash/_toSource.js","../node_modules/lodash/_baseIsNative.js","../node_modules/lodash/_getValue.js","../node_modules/lodash/_getNative.js","../node_modules/lodash/_DataView.js","../node_modules/lodash/_Map.js","../node_modules/lodash/_Promise.js","../node_modules/lodash/_Set.js","../node_modules/lodash/_WeakMap.js","../node_modules/lodash/_getTag.js","../node_modules/lodash/isEmpty.js","../public/images/redesign/decorator-search-mobile.png","../public/images/redesign/decorator-search-desktop.png","../src/niobium/scripts/components/organisms/advanced-search/advanced-search-result.vue","../src/niobium/scripts/components/organisms/advanced-search/advanced-search.vue","../src/niobium/scripts/components/organisms/advanced-search/index.js","../src/niobium/scripts/components/organisms/banner/banner.vue","../src/niobium/scripts/components/organisms/banner-dam/banner-dam.vue","../src/niobium/scripts/components/organisms/banner-placeholder/banner-placeholder.vue","../src/niobium/scripts/components/organisms/cards-wrapper/cards-wrapper.vue","../src/niobium/scripts/components/organisms/carousel/carousel.vue","../src/niobium/scripts/components/organisms/cookie-banner/cookie-banner.vue","../src/niobium/scripts/components/organisms/gallery/gallery.vue","../src/niobium/scripts/components/organisms/gallery/gallery-media.vue","../src/niobium/scripts/components/organisms/headquarters/headquarters.vue","../src/niobium/scripts/components/organisms/hero/hero.vue","../node_modules/leaflet/dist/leaflet-src.js","../node_modules/leaflet-fullscreen/dist/Leaflet.fullscreen.js","../node_modules/leaflet-active-area/src/leaflet.activearea.js","../src/niobium/scripts/components/organisms/map-v2/api.js","../src/niobium/scripts/components/organisms/map-v2/map-v2-info.vue","../src/niobium/scripts/components/organisms/map-v2/map-v2.vue","../src/niobium/scripts/components/organisms/media-library/media-library-filter.vue","../src/niobium/scripts/components/organisms/media-library/media-library-item.vue","../src/niobium/scripts/components/organisms/media-library/media-library-filter-type.vue","../src/niobium/scripts/components/organisms/media-library/paginator.vue","../src/niobium/scripts/components/organisms/media-library/media-library.vue","../src/niobium/scripts/components/organisms/multi-tabs/multi-tabs.vue","../node_modules/es-errors/index.js","../node_modules/es-errors/eval.js","../node_modules/es-errors/range.js","../node_modules/es-errors/ref.js","../node_modules/es-errors/syntax.js","../node_modules/es-errors/type.js","../node_modules/es-errors/uri.js","../node_modules/has-symbols/shams.js","../node_modules/has-symbols/index.js","../node_modules/has-proto/index.js","../node_modules/function-bind/implementation.js","../node_modules/function-bind/index.js","../node_modules/hasown/index.js","../node_modules/get-intrinsic/index.js","../node_modules/es-define-property/index.js","../node_modules/gopd/index.js","../node_modules/define-data-property/index.js","../node_modules/has-property-descriptors/index.js","../node_modules/set-function-length/index.js","../node_modules/call-bind/index.js","../node_modules/call-bind/callBound.js","../__vite-browser-external","../node_modules/object-inspect/index.js","../node_modules/side-channel/index.js","../node_modules/qs/lib/formats.js","../node_modules/qs/lib/utils.js","../node_modules/qs/lib/stringify.js","../node_modules/qs/lib/parse.js","../node_modules/qs/lib/index.js","../src/niobium/scripts/components/organisms/nt-form/nt-form.vue","../src/niobium/scripts/components/organisms/nt-template-item/nt-template-item.vue","../node_modules/pdfobject/pdfobject.js","../src/niobium/scripts/components/organisms/pdf-preview/pdf-preview.vue","../src/niobium/scripts/components/organisms/pdf-preview/pdf-preview-share.vue","../public/images/facebook.svg","../public/images/twitter.svg","../public/images/email.svg","../public/images/linkedin.svg","../src/niobium/scripts/components/organisms/preview-modal/preview-modal.vue","../src/niobium/scripts/components/organisms/pdf-preview/pdf-preview-trigger.vue","../src/niobium/scripts/components/organisms/preview-modal/modal-config.vue","../src/niobium/scripts/components/organisms/recent-news-wrapper/api.js","../src/niobium/scripts/components/organisms/recent-news-wrapper/recent-news-wrapper.vue","../src/niobium/scripts/components/organisms/recent-news-wrapper/index.js","../src/niobium/scripts/components/organisms/script/script.vue","../public/images/redesign/png/error-404.png","../public/images/redesign/png/error-404-left-decorator.png","../public/images/redesign/png/error-404-right-decorator.png","../public/images/redesign/png/sb-decorator-01.png","../public/images/redesign/png/sb-decorator-02.png","../src/niobium/scripts/components/organisms/smart-banner/smart-banner.vue","../src/niobium/scripts/components/organisms/smart-banner/smart-banner--primary.vue","../src/niobium/scripts/components/organisms/smart-banner/smart-banner--secondary.vue","../src/niobium/scripts/components/organisms/smart-banner/smart-banner--tertiary.vue","../src/niobium/scripts/components/organisms/smart-banner/smart-banner--quaternary.vue","../src/niobium/scripts/components/organisms/smart-banner/smart-banner--quinary.vue","../src/niobium/scripts/components/organisms/smart-banner/smart-banner--senary.vue","../src/niobium/scripts/components/organisms/smart-banner/smart-banner--septenary.vue","../src/niobium/scripts/components/organisms/smart-banner/smart-banner--octonary.vue","../src/niobium/scripts/components/organisms/social-posts-carousel/social-posts-carousel.vue","../src/niobium/scripts/components/organisms/tabs/tabs.vue","../src/niobium/scripts/components/organisms/tabs/tabs-content.vue","../src/niobium/scripts/components/organisms/tabs/tabs-nav.vue","../src/niobium/scripts/components/organisms/topics-wrapper/topics-wrapper.vue","../src/niobium/scripts/components/organisms/videos-carousel/videos-carousel.vue","../node_modules/stickyfilljs/dist/stickyfill.js","../src/niobium/scripts/components/organisms/vt-timeline/vt-timeline.vue","../src/niobium/scripts/components/organisms/vt-video/vt-video-youku.vue","../src/niobium/scripts/components/organisms/vt-video/vt-video-youtube.vue","../src/niobium/scripts/components/organisms/vt-video/vt-video-local.vue","../src/niobium/scripts/components/organisms/vt-video/vt-video.vue","../src/niobium/scripts/components/organisms/vt-video-background/vt-video-background.vue","../src/niobium/scripts/components/organisms/index.js","../src/niobium/scripts/directives/clickextension/clickextension.js","../node_modules/lodash/_baseFindIndex.js","../node_modules/lodash/_baseIsNaN.js","../node_modules/lodash/_strictIndexOf.js","../node_modules/lodash/_baseIndexOf.js","../node_modules/lodash/isString.js","../node_modules/lodash/toFinite.js","../node_modules/lodash/toInteger.js","../node_modules/lodash/_arrayMap.js","../node_modules/lodash/_baseValues.js","../node_modules/lodash/values.js","../node_modules/lodash/includes.js","../src/niobium/scripts/directives/load-script/load-script.js","../src/niobium/scripts/directives/background/background.js","../node_modules/lodash/_baseToString.js","../node_modules/lodash/_baseSlice.js","../node_modules/lodash/_castSlice.js","../node_modules/lodash/_hasUnicode.js","../node_modules/lodash/_baseIsRegExp.js","../node_modules/lodash/isRegExp.js","../node_modules/lodash/_baseProperty.js","../node_modules/lodash/_asciiSize.js","../node_modules/lodash/_unicodeSize.js","../node_modules/lodash/_stringSize.js","../node_modules/lodash/_asciiToArray.js","../node_modules/lodash/_unicodeToArray.js","../node_modules/lodash/_stringToArray.js","../node_modules/lodash/toString.js","../node_modules/lodash/truncate.js","../src/niobium/scripts/directives/ellipsis/ellipsis.js","../src/niobium/scripts/directives/open-modal/open-modal.js","../src/niobium/scripts/directives/link/link.js","../src/niobium/scripts/directives/define-size/define-size.js","../src/niobium/scripts/directives/click-outside/click-outside.js","../src/niobium/scripts/services/sitecore-mode-service.js","../src/niobium/scripts/plugins/sc-vue-adapter-plugin/sc-vue-adapter.js","../src/niobium/scripts/plugins/sc-vue-adapter-plugin/vue-sc-plugin.js","../src/niobium/scripts/entry.js"],"sourcesContent":["/**\n* @vue/shared v3.4.21\n* (c) 2018-present Yuxi (Evan) You and Vue contributors\n* @license MIT\n**/\nfunction makeMap(str, expectsLowerCase) {\n const set = new Set(str.split(\",\"));\n return expectsLowerCase ? (val) => set.has(val.toLowerCase()) : (val) => set.has(val);\n}\n\nconst EMPTY_OBJ = !!(process.env.NODE_ENV !== \"production\") ? Object.freeze({}) : {};\nconst EMPTY_ARR = !!(process.env.NODE_ENV !== \"production\") ? Object.freeze([]) : [];\nconst NOOP = () => {\n};\nconst NO = () => false;\nconst isOn = (key) => key.charCodeAt(0) === 111 && key.charCodeAt(1) === 110 && // uppercase letter\n(key.charCodeAt(2) > 122 || key.charCodeAt(2) < 97);\nconst isModelListener = (key) => key.startsWith(\"onUpdate:\");\nconst extend = Object.assign;\nconst remove = (arr, el) => {\n const i = arr.indexOf(el);\n if (i > -1) {\n arr.splice(i, 1);\n }\n};\nconst hasOwnProperty = Object.prototype.hasOwnProperty;\nconst hasOwn = (val, key) => hasOwnProperty.call(val, key);\nconst isArray = Array.isArray;\nconst isMap = (val) => toTypeString(val) === \"[object Map]\";\nconst isSet = (val) => toTypeString(val) === \"[object Set]\";\nconst isDate = (val) => toTypeString(val) === \"[object Date]\";\nconst isRegExp = (val) => toTypeString(val) === \"[object RegExp]\";\nconst isFunction = (val) => typeof val === \"function\";\nconst isString = (val) => typeof val === \"string\";\nconst isSymbol = (val) => typeof val === \"symbol\";\nconst isObject = (val) => val !== null && typeof val === \"object\";\nconst isPromise = (val) => {\n return (isObject(val) || isFunction(val)) && isFunction(val.then) && isFunction(val.catch);\n};\nconst objectToString = Object.prototype.toString;\nconst toTypeString = (value) => objectToString.call(value);\nconst toRawType = (value) => {\n return toTypeString(value).slice(8, -1);\n};\nconst isPlainObject = (val) => toTypeString(val) === \"[object Object]\";\nconst isIntegerKey = (key) => isString(key) && key !== \"NaN\" && key[0] !== \"-\" && \"\" + parseInt(key, 10) === key;\nconst isReservedProp = /* @__PURE__ */ makeMap(\n // the leading comma is intentional so empty string \"\" is also included\n \",key,ref,ref_for,ref_key,onVnodeBeforeMount,onVnodeMounted,onVnodeBeforeUpdate,onVnodeUpdated,onVnodeBeforeUnmount,onVnodeUnmounted\"\n);\nconst isBuiltInDirective = /* @__PURE__ */ makeMap(\n \"bind,cloak,else-if,else,for,html,if,model,on,once,pre,show,slot,text,memo\"\n);\nconst cacheStringFunction = (fn) => {\n const cache = /* @__PURE__ */ Object.create(null);\n return (str) => {\n const hit = cache[str];\n return hit || (cache[str] = fn(str));\n };\n};\nconst camelizeRE = /-(\\w)/g;\nconst camelize = cacheStringFunction((str) => {\n return str.replace(camelizeRE, (_, c) => c ? c.toUpperCase() : \"\");\n});\nconst hyphenateRE = /\\B([A-Z])/g;\nconst hyphenate = cacheStringFunction(\n (str) => str.replace(hyphenateRE, \"-$1\").toLowerCase()\n);\nconst capitalize = cacheStringFunction((str) => {\n return str.charAt(0).toUpperCase() + str.slice(1);\n});\nconst toHandlerKey = cacheStringFunction((str) => {\n const s = str ? `on${capitalize(str)}` : ``;\n return s;\n});\nconst hasChanged = (value, oldValue) => !Object.is(value, oldValue);\nconst invokeArrayFns = (fns, arg) => {\n for (let i = 0; i < fns.length; i++) {\n fns[i](arg);\n }\n};\nconst def = (obj, key, value) => {\n Object.defineProperty(obj, key, {\n configurable: true,\n enumerable: false,\n value\n });\n};\nconst looseToNumber = (val) => {\n const n = parseFloat(val);\n return isNaN(n) ? val : n;\n};\nconst toNumber = (val) => {\n const n = isString(val) ? Number(val) : NaN;\n return isNaN(n) ? val : n;\n};\nlet _globalThis;\nconst getGlobalThis = () => {\n return _globalThis || (_globalThis = typeof globalThis !== \"undefined\" ? globalThis : typeof self !== \"undefined\" ? self : typeof window !== \"undefined\" ? window : typeof global !== \"undefined\" ? global : {});\n};\nconst identRE = /^[_$a-zA-Z\\xA0-\\uFFFF][_$a-zA-Z0-9\\xA0-\\uFFFF]*$/;\nfunction genPropsAccessExp(name) {\n return identRE.test(name) ? `__props.${name}` : `__props[${JSON.stringify(name)}]`;\n}\n\nconst PatchFlags = {\n \"TEXT\": 1,\n \"1\": \"TEXT\",\n \"CLASS\": 2,\n \"2\": \"CLASS\",\n \"STYLE\": 4,\n \"4\": \"STYLE\",\n \"PROPS\": 8,\n \"8\": \"PROPS\",\n \"FULL_PROPS\": 16,\n \"16\": \"FULL_PROPS\",\n \"NEED_HYDRATION\": 32,\n \"32\": \"NEED_HYDRATION\",\n \"STABLE_FRAGMENT\": 64,\n \"64\": \"STABLE_FRAGMENT\",\n \"KEYED_FRAGMENT\": 128,\n \"128\": \"KEYED_FRAGMENT\",\n \"UNKEYED_FRAGMENT\": 256,\n \"256\": \"UNKEYED_FRAGMENT\",\n \"NEED_PATCH\": 512,\n \"512\": \"NEED_PATCH\",\n \"DYNAMIC_SLOTS\": 1024,\n \"1024\": \"DYNAMIC_SLOTS\",\n \"DEV_ROOT_FRAGMENT\": 2048,\n \"2048\": \"DEV_ROOT_FRAGMENT\",\n \"HOISTED\": -1,\n \"-1\": \"HOISTED\",\n \"BAIL\": -2,\n \"-2\": \"BAIL\"\n};\nconst PatchFlagNames = {\n [1]: `TEXT`,\n [2]: `CLASS`,\n [4]: `STYLE`,\n [8]: `PROPS`,\n [16]: `FULL_PROPS`,\n [32]: `NEED_HYDRATION`,\n [64]: `STABLE_FRAGMENT`,\n [128]: `KEYED_FRAGMENT`,\n [256]: `UNKEYED_FRAGMENT`,\n [512]: `NEED_PATCH`,\n [1024]: `DYNAMIC_SLOTS`,\n [2048]: `DEV_ROOT_FRAGMENT`,\n [-1]: `HOISTED`,\n [-2]: `BAIL`\n};\n\nconst ShapeFlags = {\n \"ELEMENT\": 1,\n \"1\": \"ELEMENT\",\n \"FUNCTIONAL_COMPONENT\": 2,\n \"2\": \"FUNCTIONAL_COMPONENT\",\n \"STATEFUL_COMPONENT\": 4,\n \"4\": \"STATEFUL_COMPONENT\",\n \"TEXT_CHILDREN\": 8,\n \"8\": \"TEXT_CHILDREN\",\n \"ARRAY_CHILDREN\": 16,\n \"16\": \"ARRAY_CHILDREN\",\n \"SLOTS_CHILDREN\": 32,\n \"32\": \"SLOTS_CHILDREN\",\n \"TELEPORT\": 64,\n \"64\": \"TELEPORT\",\n \"SUSPENSE\": 128,\n \"128\": \"SUSPENSE\",\n \"COMPONENT_SHOULD_KEEP_ALIVE\": 256,\n \"256\": \"COMPONENT_SHOULD_KEEP_ALIVE\",\n \"COMPONENT_KEPT_ALIVE\": 512,\n \"512\": \"COMPONENT_KEPT_ALIVE\",\n \"COMPONENT\": 6,\n \"6\": \"COMPONENT\"\n};\n\nconst SlotFlags = {\n \"STABLE\": 1,\n \"1\": \"STABLE\",\n \"DYNAMIC\": 2,\n \"2\": \"DYNAMIC\",\n \"FORWARDED\": 3,\n \"3\": \"FORWARDED\"\n};\nconst slotFlagsText = {\n [1]: \"STABLE\",\n [2]: \"DYNAMIC\",\n [3]: \"FORWARDED\"\n};\n\nconst GLOBALS_ALLOWED = \"Infinity,undefined,NaN,isFinite,isNaN,parseFloat,parseInt,decodeURI,decodeURIComponent,encodeURI,encodeURIComponent,Math,Number,Date,Array,Object,Boolean,String,RegExp,Map,Set,JSON,Intl,BigInt,console,Error\";\nconst isGloballyAllowed = /* @__PURE__ */ makeMap(GLOBALS_ALLOWED);\nconst isGloballyWhitelisted = isGloballyAllowed;\n\nconst range = 2;\nfunction generateCodeFrame(source, start = 0, end = source.length) {\n let lines = source.split(/(\\r?\\n)/);\n const newlineSequences = lines.filter((_, idx) => idx % 2 === 1);\n lines = lines.filter((_, idx) => idx % 2 === 0);\n let count = 0;\n const res = [];\n for (let i = 0; i < lines.length; i++) {\n count += lines[i].length + (newlineSequences[i] && newlineSequences[i].length || 0);\n if (count >= start) {\n for (let j = i - range; j <= i + range || end > count; j++) {\n if (j < 0 || j >= lines.length)\n continue;\n const line = j + 1;\n res.push(\n `${line}${\" \".repeat(Math.max(3 - String(line).length, 0))}| ${lines[j]}`\n );\n const lineLength = lines[j].length;\n const newLineSeqLength = newlineSequences[j] && newlineSequences[j].length || 0;\n if (j === i) {\n const pad = start - (count - (lineLength + newLineSeqLength));\n const length = Math.max(\n 1,\n end > count ? lineLength - pad : end - start\n );\n res.push(` | ` + \" \".repeat(pad) + \"^\".repeat(length));\n } else if (j > i) {\n if (end > count) {\n const length = Math.max(Math.min(end - count, lineLength), 1);\n res.push(` | ` + \"^\".repeat(length));\n }\n count += lineLength + newLineSeqLength;\n }\n }\n break;\n }\n }\n return res.join(\"\\n\");\n}\n\nfunction normalizeStyle(value) {\n if (isArray(value)) {\n const res = {};\n for (let i = 0; i < value.length; i++) {\n const item = value[i];\n const normalized = isString(item) ? parseStringStyle(item) : normalizeStyle(item);\n if (normalized) {\n for (const key in normalized) {\n res[key] = normalized[key];\n }\n }\n }\n return res;\n } else if (isString(value) || isObject(value)) {\n return value;\n }\n}\nconst listDelimiterRE = /;(?![^(]*\\))/g;\nconst propertyDelimiterRE = /:([^]+)/;\nconst styleCommentRE = /\\/\\*[^]*?\\*\\//g;\nfunction parseStringStyle(cssText) {\n const ret = {};\n cssText.replace(styleCommentRE, \"\").split(listDelimiterRE).forEach((item) => {\n if (item) {\n const tmp = item.split(propertyDelimiterRE);\n tmp.length > 1 && (ret[tmp[0].trim()] = tmp[1].trim());\n }\n });\n return ret;\n}\nfunction stringifyStyle(styles) {\n let ret = \"\";\n if (!styles || isString(styles)) {\n return ret;\n }\n for (const key in styles) {\n const value = styles[key];\n const normalizedKey = key.startsWith(`--`) ? key : hyphenate(key);\n if (isString(value) || typeof value === \"number\") {\n ret += `${normalizedKey}:${value};`;\n }\n }\n return ret;\n}\nfunction normalizeClass(value) {\n let res = \"\";\n if (isString(value)) {\n res = value;\n } else if (isArray(value)) {\n for (let i = 0; i < value.length; i++) {\n const normalized = normalizeClass(value[i]);\n if (normalized) {\n res += normalized + \" \";\n }\n }\n } else if (isObject(value)) {\n for (const name in value) {\n if (value[name]) {\n res += name + \" \";\n }\n }\n }\n return res.trim();\n}\nfunction normalizeProps(props) {\n if (!props)\n return null;\n let { class: klass, style } = props;\n if (klass && !isString(klass)) {\n props.class = normalizeClass(klass);\n }\n if (style) {\n props.style = normalizeStyle(style);\n }\n return props;\n}\n\nconst HTML_TAGS = \"html,body,base,head,link,meta,style,title,address,article,aside,footer,header,hgroup,h1,h2,h3,h4,h5,h6,nav,section,div,dd,dl,dt,figcaption,figure,picture,hr,img,li,main,ol,p,pre,ul,a,b,abbr,bdi,bdo,br,cite,code,data,dfn,em,i,kbd,mark,q,rp,rt,ruby,s,samp,small,span,strong,sub,sup,time,u,var,wbr,area,audio,map,track,video,embed,object,param,source,canvas,script,noscript,del,ins,caption,col,colgroup,table,thead,tbody,td,th,tr,button,datalist,fieldset,form,input,label,legend,meter,optgroup,option,output,progress,select,textarea,details,dialog,menu,summary,template,blockquote,iframe,tfoot\";\nconst SVG_TAGS = \"svg,animate,animateMotion,animateTransform,circle,clipPath,color-profile,defs,desc,discard,ellipse,feBlend,feColorMatrix,feComponentTransfer,feComposite,feConvolveMatrix,feDiffuseLighting,feDisplacementMap,feDistantLight,feDropShadow,feFlood,feFuncA,feFuncB,feFuncG,feFuncR,feGaussianBlur,feImage,feMerge,feMergeNode,feMorphology,feOffset,fePointLight,feSpecularLighting,feSpotLight,feTile,feTurbulence,filter,foreignObject,g,hatch,hatchpath,image,line,linearGradient,marker,mask,mesh,meshgradient,meshpatch,meshrow,metadata,mpath,path,pattern,polygon,polyline,radialGradient,rect,set,solidcolor,stop,switch,symbol,text,textPath,title,tspan,unknown,use,view\";\nconst MATH_TAGS = \"annotation,annotation-xml,maction,maligngroup,malignmark,math,menclose,merror,mfenced,mfrac,mfraction,mglyph,mi,mlabeledtr,mlongdiv,mmultiscripts,mn,mo,mover,mpadded,mphantom,mprescripts,mroot,mrow,ms,mscarries,mscarry,msgroup,msline,mspace,msqrt,msrow,mstack,mstyle,msub,msubsup,msup,mtable,mtd,mtext,mtr,munder,munderover,none,semantics\";\nconst VOID_TAGS = \"area,base,br,col,embed,hr,img,input,link,meta,param,source,track,wbr\";\nconst isHTMLTag = /* @__PURE__ */ makeMap(HTML_TAGS);\nconst isSVGTag = /* @__PURE__ */ makeMap(SVG_TAGS);\nconst isMathMLTag = /* @__PURE__ */ makeMap(MATH_TAGS);\nconst isVoidTag = /* @__PURE__ */ makeMap(VOID_TAGS);\n\nconst specialBooleanAttrs = `itemscope,allowfullscreen,formnovalidate,ismap,nomodule,novalidate,readonly`;\nconst isSpecialBooleanAttr = /* @__PURE__ */ makeMap(specialBooleanAttrs);\nconst isBooleanAttr = /* @__PURE__ */ makeMap(\n specialBooleanAttrs + `,async,autofocus,autoplay,controls,default,defer,disabled,hidden,inert,loop,open,required,reversed,scoped,seamless,checked,muted,multiple,selected`\n);\nfunction includeBooleanAttr(value) {\n return !!value || value === \"\";\n}\nconst unsafeAttrCharRE = /[>/=\"'\\u0009\\u000a\\u000c\\u0020]/;\nconst attrValidationCache = {};\nfunction isSSRSafeAttrName(name) {\n if (attrValidationCache.hasOwnProperty(name)) {\n return attrValidationCache[name];\n }\n const isUnsafe = unsafeAttrCharRE.test(name);\n if (isUnsafe) {\n console.error(`unsafe attribute name: ${name}`);\n }\n return attrValidationCache[name] = !isUnsafe;\n}\nconst propsToAttrMap = {\n acceptCharset: \"accept-charset\",\n className: \"class\",\n htmlFor: \"for\",\n httpEquiv: \"http-equiv\"\n};\nconst isKnownHtmlAttr = /* @__PURE__ */ makeMap(\n `accept,accept-charset,accesskey,action,align,allow,alt,async,autocapitalize,autocomplete,autofocus,autoplay,background,bgcolor,border,buffered,capture,challenge,charset,checked,cite,class,code,codebase,color,cols,colspan,content,contenteditable,contextmenu,controls,coords,crossorigin,csp,data,datetime,decoding,default,defer,dir,dirname,disabled,download,draggable,dropzone,enctype,enterkeyhint,for,form,formaction,formenctype,formmethod,formnovalidate,formtarget,headers,height,hidden,high,href,hreflang,http-equiv,icon,id,importance,inert,integrity,ismap,itemprop,keytype,kind,label,lang,language,loading,list,loop,low,manifest,max,maxlength,minlength,media,min,multiple,muted,name,novalidate,open,optimum,pattern,ping,placeholder,poster,preload,radiogroup,readonly,referrerpolicy,rel,required,reversed,rows,rowspan,sandbox,scope,scoped,selected,shape,size,sizes,slot,span,spellcheck,src,srcdoc,srclang,srcset,start,step,style,summary,tabindex,target,title,translate,type,usemap,value,width,wrap`\n);\nconst isKnownSvgAttr = /* @__PURE__ */ makeMap(\n `xmlns,accent-height,accumulate,additive,alignment-baseline,alphabetic,amplitude,arabic-form,ascent,attributeName,attributeType,azimuth,baseFrequency,baseline-shift,baseProfile,bbox,begin,bias,by,calcMode,cap-height,class,clip,clipPathUnits,clip-path,clip-rule,color,color-interpolation,color-interpolation-filters,color-profile,color-rendering,contentScriptType,contentStyleType,crossorigin,cursor,cx,cy,d,decelerate,descent,diffuseConstant,direction,display,divisor,dominant-baseline,dur,dx,dy,edgeMode,elevation,enable-background,end,exponent,fill,fill-opacity,fill-rule,filter,filterRes,filterUnits,flood-color,flood-opacity,font-family,font-size,font-size-adjust,font-stretch,font-style,font-variant,font-weight,format,from,fr,fx,fy,g1,g2,glyph-name,glyph-orientation-horizontal,glyph-orientation-vertical,glyphRef,gradientTransform,gradientUnits,hanging,height,href,hreflang,horiz-adv-x,horiz-origin-x,id,ideographic,image-rendering,in,in2,intercept,k,k1,k2,k3,k4,kernelMatrix,kernelUnitLength,kerning,keyPoints,keySplines,keyTimes,lang,lengthAdjust,letter-spacing,lighting-color,limitingConeAngle,local,marker-end,marker-mid,marker-start,markerHeight,markerUnits,markerWidth,mask,maskContentUnits,maskUnits,mathematical,max,media,method,min,mode,name,numOctaves,offset,opacity,operator,order,orient,orientation,origin,overflow,overline-position,overline-thickness,panose-1,paint-order,path,pathLength,patternContentUnits,patternTransform,patternUnits,ping,pointer-events,points,pointsAtX,pointsAtY,pointsAtZ,preserveAlpha,preserveAspectRatio,primitiveUnits,r,radius,referrerPolicy,refX,refY,rel,rendering-intent,repeatCount,repeatDur,requiredExtensions,requiredFeatures,restart,result,rotate,rx,ry,scale,seed,shape-rendering,slope,spacing,specularConstant,specularExponent,speed,spreadMethod,startOffset,stdDeviation,stemh,stemv,stitchTiles,stop-color,stop-opacity,strikethrough-position,strikethrough-thickness,string,stroke,stroke-dasharray,stroke-dashoffset,stroke-linecap,stroke-linejoin,stroke-miterlimit,stroke-opacity,stroke-width,style,surfaceScale,systemLanguage,tabindex,tableValues,target,targetX,targetY,text-anchor,text-decoration,text-rendering,textLength,to,transform,transform-origin,type,u1,u2,underline-position,underline-thickness,unicode,unicode-bidi,unicode-range,units-per-em,v-alphabetic,v-hanging,v-ideographic,v-mathematical,values,vector-effect,version,vert-adv-y,vert-origin-x,vert-origin-y,viewBox,viewTarget,visibility,width,widths,word-spacing,writing-mode,x,x-height,x1,x2,xChannelSelector,xlink:actuate,xlink:arcrole,xlink:href,xlink:role,xlink:show,xlink:title,xlink:type,xmlns:xlink,xml:base,xml:lang,xml:space,y,y1,y2,yChannelSelector,z,zoomAndPan`\n);\nfunction isRenderableAttrValue(value) {\n if (value == null) {\n return false;\n }\n const type = typeof value;\n return type === \"string\" || type === \"number\" || type === \"boolean\";\n}\n\nconst escapeRE = /[\"'&<>]/;\nfunction escapeHtml(string) {\n const str = \"\" + string;\n const match = escapeRE.exec(str);\n if (!match) {\n return str;\n }\n let html = \"\";\n let escaped;\n let index;\n let lastIndex = 0;\n for (index = match.index; index < str.length; index++) {\n switch (str.charCodeAt(index)) {\n case 34:\n escaped = \""\";\n break;\n case 38:\n escaped = \"&\";\n break;\n case 39:\n escaped = \"'\";\n break;\n case 60:\n escaped = \"<\";\n break;\n case 62:\n escaped = \">\";\n break;\n default:\n continue;\n }\n if (lastIndex !== index) {\n html += str.slice(lastIndex, index);\n }\n lastIndex = index + 1;\n html += escaped;\n }\n return lastIndex !== index ? html + str.slice(lastIndex, index) : html;\n}\nconst commentStripRE = /^-?>||--!>| looseEqual(item, val));\n}\n\nconst toDisplayString = (val) => {\n return isString(val) ? val : val == null ? \"\" : isArray(val) || isObject(val) && (val.toString === objectToString || !isFunction(val.toString)) ? JSON.stringify(val, replacer, 2) : String(val);\n};\nconst replacer = (_key, val) => {\n if (val && val.__v_isRef) {\n return replacer(_key, val.value);\n } else if (isMap(val)) {\n return {\n [`Map(${val.size})`]: [...val.entries()].reduce(\n (entries, [key, val2], i) => {\n entries[stringifySymbol(key, i) + \" =>\"] = val2;\n return entries;\n },\n {}\n )\n };\n } else if (isSet(val)) {\n return {\n [`Set(${val.size})`]: [...val.values()].map((v) => stringifySymbol(v))\n };\n } else if (isSymbol(val)) {\n return stringifySymbol(val);\n } else if (isObject(val) && !isArray(val) && !isPlainObject(val)) {\n return String(val);\n }\n return val;\n};\nconst stringifySymbol = (v, i = \"\") => {\n var _a;\n return isSymbol(v) ? `Symbol(${(_a = v.description) != null ? _a : i})` : v;\n};\n\nexport { EMPTY_ARR, EMPTY_OBJ, NO, NOOP, PatchFlagNames, PatchFlags, ShapeFlags, SlotFlags, camelize, capitalize, def, escapeHtml, escapeHtmlComment, extend, genPropsAccessExp, generateCodeFrame, getGlobalThis, hasChanged, hasOwn, hyphenate, includeBooleanAttr, invokeArrayFns, isArray, isBooleanAttr, isBuiltInDirective, isDate, isFunction, isGloballyAllowed, isGloballyWhitelisted, isHTMLTag, isIntegerKey, isKnownHtmlAttr, isKnownSvgAttr, isMap, isMathMLTag, isModelListener, isObject, isOn, isPlainObject, isPromise, isRegExp, isRenderableAttrValue, isReservedProp, isSSRSafeAttrName, isSVGTag, isSet, isSpecialBooleanAttr, isString, isSymbol, isVoidTag, looseEqual, looseIndexOf, looseToNumber, makeMap, normalizeClass, normalizeProps, normalizeStyle, objectToString, parseStringStyle, propsToAttrMap, remove, slotFlagsText, stringifyStyle, toDisplayString, toHandlerKey, toNumber, toRawType, toTypeString };\n","/**\n* @vue/reactivity v3.4.21\n* (c) 2018-present Yuxi (Evan) You and Vue contributors\n* @license MIT\n**/\nimport { NOOP, extend, isArray, isSymbol, isMap, isIntegerKey, hasOwn, hasChanged, isObject, makeMap, capitalize, toRawType, def, isFunction } from '@vue/shared';\n\nfunction warn(msg, ...args) {\n console.warn(`[Vue warn] ${msg}`, ...args);\n}\n\nlet activeEffectScope;\nclass EffectScope {\n constructor(detached = false) {\n this.detached = detached;\n /**\n * @internal\n */\n this._active = true;\n /**\n * @internal\n */\n this.effects = [];\n /**\n * @internal\n */\n this.cleanups = [];\n this.parent = activeEffectScope;\n if (!detached && activeEffectScope) {\n this.index = (activeEffectScope.scopes || (activeEffectScope.scopes = [])).push(\n this\n ) - 1;\n }\n }\n get active() {\n return this._active;\n }\n run(fn) {\n if (this._active) {\n const currentEffectScope = activeEffectScope;\n try {\n activeEffectScope = this;\n return fn();\n } finally {\n activeEffectScope = currentEffectScope;\n }\n } else if (!!(process.env.NODE_ENV !== \"production\")) {\n warn(`cannot run an inactive effect scope.`);\n }\n }\n /**\n * This should only be called on non-detached scopes\n * @internal\n */\n on() {\n activeEffectScope = this;\n }\n /**\n * This should only be called on non-detached scopes\n * @internal\n */\n off() {\n activeEffectScope = this.parent;\n }\n stop(fromParent) {\n if (this._active) {\n let i, l;\n for (i = 0, l = this.effects.length; i < l; i++) {\n this.effects[i].stop();\n }\n for (i = 0, l = this.cleanups.length; i < l; i++) {\n this.cleanups[i]();\n }\n if (this.scopes) {\n for (i = 0, l = this.scopes.length; i < l; i++) {\n this.scopes[i].stop(true);\n }\n }\n if (!this.detached && this.parent && !fromParent) {\n const last = this.parent.scopes.pop();\n if (last && last !== this) {\n this.parent.scopes[this.index] = last;\n last.index = this.index;\n }\n }\n this.parent = void 0;\n this._active = false;\n }\n }\n}\nfunction effectScope(detached) {\n return new EffectScope(detached);\n}\nfunction recordEffectScope(effect, scope = activeEffectScope) {\n if (scope && scope.active) {\n scope.effects.push(effect);\n }\n}\nfunction getCurrentScope() {\n return activeEffectScope;\n}\nfunction onScopeDispose(fn) {\n if (activeEffectScope) {\n activeEffectScope.cleanups.push(fn);\n } else if (!!(process.env.NODE_ENV !== \"production\")) {\n warn(\n `onScopeDispose() is called when there is no active effect scope to be associated with.`\n );\n }\n}\n\nlet activeEffect;\nclass ReactiveEffect {\n constructor(fn, trigger, scheduler, scope) {\n this.fn = fn;\n this.trigger = trigger;\n this.scheduler = scheduler;\n this.active = true;\n this.deps = [];\n /**\n * @internal\n */\n this._dirtyLevel = 4;\n /**\n * @internal\n */\n this._trackId = 0;\n /**\n * @internal\n */\n this._runnings = 0;\n /**\n * @internal\n */\n this._shouldSchedule = false;\n /**\n * @internal\n */\n this._depsLength = 0;\n recordEffectScope(this, scope);\n }\n get dirty() {\n if (this._dirtyLevel === 2 || this._dirtyLevel === 3) {\n this._dirtyLevel = 1;\n pauseTracking();\n for (let i = 0; i < this._depsLength; i++) {\n const dep = this.deps[i];\n if (dep.computed) {\n triggerComputed(dep.computed);\n if (this._dirtyLevel >= 4) {\n break;\n }\n }\n }\n if (this._dirtyLevel === 1) {\n this._dirtyLevel = 0;\n }\n resetTracking();\n }\n return this._dirtyLevel >= 4;\n }\n set dirty(v) {\n this._dirtyLevel = v ? 4 : 0;\n }\n run() {\n this._dirtyLevel = 0;\n if (!this.active) {\n return this.fn();\n }\n let lastShouldTrack = shouldTrack;\n let lastEffect = activeEffect;\n try {\n shouldTrack = true;\n activeEffect = this;\n this._runnings++;\n preCleanupEffect(this);\n return this.fn();\n } finally {\n postCleanupEffect(this);\n this._runnings--;\n activeEffect = lastEffect;\n shouldTrack = lastShouldTrack;\n }\n }\n stop() {\n var _a;\n if (this.active) {\n preCleanupEffect(this);\n postCleanupEffect(this);\n (_a = this.onStop) == null ? void 0 : _a.call(this);\n this.active = false;\n }\n }\n}\nfunction triggerComputed(computed) {\n return computed.value;\n}\nfunction preCleanupEffect(effect2) {\n effect2._trackId++;\n effect2._depsLength = 0;\n}\nfunction postCleanupEffect(effect2) {\n if (effect2.deps.length > effect2._depsLength) {\n for (let i = effect2._depsLength; i < effect2.deps.length; i++) {\n cleanupDepEffect(effect2.deps[i], effect2);\n }\n effect2.deps.length = effect2._depsLength;\n }\n}\nfunction cleanupDepEffect(dep, effect2) {\n const trackId = dep.get(effect2);\n if (trackId !== void 0 && effect2._trackId !== trackId) {\n dep.delete(effect2);\n if (dep.size === 0) {\n dep.cleanup();\n }\n }\n}\nfunction effect(fn, options) {\n if (fn.effect instanceof ReactiveEffect) {\n fn = fn.effect.fn;\n }\n const _effect = new ReactiveEffect(fn, NOOP, () => {\n if (_effect.dirty) {\n _effect.run();\n }\n });\n if (options) {\n extend(_effect, options);\n if (options.scope)\n recordEffectScope(_effect, options.scope);\n }\n if (!options || !options.lazy) {\n _effect.run();\n }\n const runner = _effect.run.bind(_effect);\n runner.effect = _effect;\n return runner;\n}\nfunction stop(runner) {\n runner.effect.stop();\n}\nlet shouldTrack = true;\nlet pauseScheduleStack = 0;\nconst trackStack = [];\nfunction pauseTracking() {\n trackStack.push(shouldTrack);\n shouldTrack = false;\n}\nfunction enableTracking() {\n trackStack.push(shouldTrack);\n shouldTrack = true;\n}\nfunction resetTracking() {\n const last = trackStack.pop();\n shouldTrack = last === void 0 ? true : last;\n}\nfunction pauseScheduling() {\n pauseScheduleStack++;\n}\nfunction resetScheduling() {\n pauseScheduleStack--;\n while (!pauseScheduleStack && queueEffectSchedulers.length) {\n queueEffectSchedulers.shift()();\n }\n}\nfunction trackEffect(effect2, dep, debuggerEventExtraInfo) {\n var _a;\n if (dep.get(effect2) !== effect2._trackId) {\n dep.set(effect2, effect2._trackId);\n const oldDep = effect2.deps[effect2._depsLength];\n if (oldDep !== dep) {\n if (oldDep) {\n cleanupDepEffect(oldDep, effect2);\n }\n effect2.deps[effect2._depsLength++] = dep;\n } else {\n effect2._depsLength++;\n }\n if (!!(process.env.NODE_ENV !== \"production\")) {\n (_a = effect2.onTrack) == null ? void 0 : _a.call(effect2, extend({ effect: effect2 }, debuggerEventExtraInfo));\n }\n }\n}\nconst queueEffectSchedulers = [];\nfunction triggerEffects(dep, dirtyLevel, debuggerEventExtraInfo) {\n var _a;\n pauseScheduling();\n for (const effect2 of dep.keys()) {\n let tracking;\n if (effect2._dirtyLevel < dirtyLevel && (tracking != null ? tracking : tracking = dep.get(effect2) === effect2._trackId)) {\n effect2._shouldSchedule || (effect2._shouldSchedule = effect2._dirtyLevel === 0);\n effect2._dirtyLevel = dirtyLevel;\n }\n if (effect2._shouldSchedule && (tracking != null ? tracking : tracking = dep.get(effect2) === effect2._trackId)) {\n if (!!(process.env.NODE_ENV !== \"production\")) {\n (_a = effect2.onTrigger) == null ? void 0 : _a.call(effect2, extend({ effect: effect2 }, debuggerEventExtraInfo));\n }\n effect2.trigger();\n if ((!effect2._runnings || effect2.allowRecurse) && effect2._dirtyLevel !== 2) {\n effect2._shouldSchedule = false;\n if (effect2.scheduler) {\n queueEffectSchedulers.push(effect2.scheduler);\n }\n }\n }\n }\n resetScheduling();\n}\n\nconst createDep = (cleanup, computed) => {\n const dep = /* @__PURE__ */ new Map();\n dep.cleanup = cleanup;\n dep.computed = computed;\n return dep;\n};\n\nconst targetMap = /* @__PURE__ */ new WeakMap();\nconst ITERATE_KEY = Symbol(!!(process.env.NODE_ENV !== \"production\") ? \"iterate\" : \"\");\nconst MAP_KEY_ITERATE_KEY = Symbol(!!(process.env.NODE_ENV !== \"production\") ? \"Map key iterate\" : \"\");\nfunction track(target, type, key) {\n if (shouldTrack && activeEffect) {\n let depsMap = targetMap.get(target);\n if (!depsMap) {\n targetMap.set(target, depsMap = /* @__PURE__ */ new Map());\n }\n let dep = depsMap.get(key);\n if (!dep) {\n depsMap.set(key, dep = createDep(() => depsMap.delete(key)));\n }\n trackEffect(\n activeEffect,\n dep,\n !!(process.env.NODE_ENV !== \"production\") ? {\n target,\n type,\n key\n } : void 0\n );\n }\n}\nfunction trigger(target, type, key, newValue, oldValue, oldTarget) {\n const depsMap = targetMap.get(target);\n if (!depsMap) {\n return;\n }\n let deps = [];\n if (type === \"clear\") {\n deps = [...depsMap.values()];\n } else if (key === \"length\" && isArray(target)) {\n const newLength = Number(newValue);\n depsMap.forEach((dep, key2) => {\n if (key2 === \"length\" || !isSymbol(key2) && key2 >= newLength) {\n deps.push(dep);\n }\n });\n } else {\n if (key !== void 0) {\n deps.push(depsMap.get(key));\n }\n switch (type) {\n case \"add\":\n if (!isArray(target)) {\n deps.push(depsMap.get(ITERATE_KEY));\n if (isMap(target)) {\n deps.push(depsMap.get(MAP_KEY_ITERATE_KEY));\n }\n } else if (isIntegerKey(key)) {\n deps.push(depsMap.get(\"length\"));\n }\n break;\n case \"delete\":\n if (!isArray(target)) {\n deps.push(depsMap.get(ITERATE_KEY));\n if (isMap(target)) {\n deps.push(depsMap.get(MAP_KEY_ITERATE_KEY));\n }\n }\n break;\n case \"set\":\n if (isMap(target)) {\n deps.push(depsMap.get(ITERATE_KEY));\n }\n break;\n }\n }\n pauseScheduling();\n for (const dep of deps) {\n if (dep) {\n triggerEffects(\n dep,\n 4,\n !!(process.env.NODE_ENV !== \"production\") ? {\n target,\n type,\n key,\n newValue,\n oldValue,\n oldTarget\n } : void 0\n );\n }\n }\n resetScheduling();\n}\nfunction getDepFromReactive(object, key) {\n var _a;\n return (_a = targetMap.get(object)) == null ? void 0 : _a.get(key);\n}\n\nconst isNonTrackableKeys = /* @__PURE__ */ makeMap(`__proto__,__v_isRef,__isVue`);\nconst builtInSymbols = new Set(\n /* @__PURE__ */ Object.getOwnPropertyNames(Symbol).filter((key) => key !== \"arguments\" && key !== \"caller\").map((key) => Symbol[key]).filter(isSymbol)\n);\nconst arrayInstrumentations = /* @__PURE__ */ createArrayInstrumentations();\nfunction createArrayInstrumentations() {\n const instrumentations = {};\n [\"includes\", \"indexOf\", \"lastIndexOf\"].forEach((key) => {\n instrumentations[key] = function(...args) {\n const arr = toRaw(this);\n for (let i = 0, l = this.length; i < l; i++) {\n track(arr, \"get\", i + \"\");\n }\n const res = arr[key](...args);\n if (res === -1 || res === false) {\n return arr[key](...args.map(toRaw));\n } else {\n return res;\n }\n };\n });\n [\"push\", \"pop\", \"shift\", \"unshift\", \"splice\"].forEach((key) => {\n instrumentations[key] = function(...args) {\n pauseTracking();\n pauseScheduling();\n const res = toRaw(this)[key].apply(this, args);\n resetScheduling();\n resetTracking();\n return res;\n };\n });\n return instrumentations;\n}\nfunction hasOwnProperty(key) {\n const obj = toRaw(this);\n track(obj, \"has\", key);\n return obj.hasOwnProperty(key);\n}\nclass BaseReactiveHandler {\n constructor(_isReadonly = false, _isShallow = false) {\n this._isReadonly = _isReadonly;\n this._isShallow = _isShallow;\n }\n get(target, key, receiver) {\n const isReadonly2 = this._isReadonly, isShallow2 = this._isShallow;\n if (key === \"__v_isReactive\") {\n return !isReadonly2;\n } else if (key === \"__v_isReadonly\") {\n return isReadonly2;\n } else if (key === \"__v_isShallow\") {\n return isShallow2;\n } else if (key === \"__v_raw\") {\n if (receiver === (isReadonly2 ? isShallow2 ? shallowReadonlyMap : readonlyMap : isShallow2 ? shallowReactiveMap : reactiveMap).get(target) || // receiver is not the reactive proxy, but has the same prototype\n // this means the reciever is a user proxy of the reactive proxy\n Object.getPrototypeOf(target) === Object.getPrototypeOf(receiver)) {\n return target;\n }\n return;\n }\n const targetIsArray = isArray(target);\n if (!isReadonly2) {\n if (targetIsArray && hasOwn(arrayInstrumentations, key)) {\n return Reflect.get(arrayInstrumentations, key, receiver);\n }\n if (key === \"hasOwnProperty\") {\n return hasOwnProperty;\n }\n }\n const res = Reflect.get(target, key, receiver);\n if (isSymbol(key) ? builtInSymbols.has(key) : isNonTrackableKeys(key)) {\n return res;\n }\n if (!isReadonly2) {\n track(target, \"get\", key);\n }\n if (isShallow2) {\n return res;\n }\n if (isRef(res)) {\n return targetIsArray && isIntegerKey(key) ? res : res.value;\n }\n if (isObject(res)) {\n return isReadonly2 ? readonly(res) : reactive(res);\n }\n return res;\n }\n}\nclass MutableReactiveHandler extends BaseReactiveHandler {\n constructor(isShallow2 = false) {\n super(false, isShallow2);\n }\n set(target, key, value, receiver) {\n let oldValue = target[key];\n if (!this._isShallow) {\n const isOldValueReadonly = isReadonly(oldValue);\n if (!isShallow(value) && !isReadonly(value)) {\n oldValue = toRaw(oldValue);\n value = toRaw(value);\n }\n if (!isArray(target) && isRef(oldValue) && !isRef(value)) {\n if (isOldValueReadonly) {\n return false;\n } else {\n oldValue.value = value;\n return true;\n }\n }\n }\n const hadKey = isArray(target) && isIntegerKey(key) ? Number(key) < target.length : hasOwn(target, key);\n const result = Reflect.set(target, key, value, receiver);\n if (target === toRaw(receiver)) {\n if (!hadKey) {\n trigger(target, \"add\", key, value);\n } else if (hasChanged(value, oldValue)) {\n trigger(target, \"set\", key, value, oldValue);\n }\n }\n return result;\n }\n deleteProperty(target, key) {\n const hadKey = hasOwn(target, key);\n const oldValue = target[key];\n const result = Reflect.deleteProperty(target, key);\n if (result && hadKey) {\n trigger(target, \"delete\", key, void 0, oldValue);\n }\n return result;\n }\n has(target, key) {\n const result = Reflect.has(target, key);\n if (!isSymbol(key) || !builtInSymbols.has(key)) {\n track(target, \"has\", key);\n }\n return result;\n }\n ownKeys(target) {\n track(\n target,\n \"iterate\",\n isArray(target) ? \"length\" : ITERATE_KEY\n );\n return Reflect.ownKeys(target);\n }\n}\nclass ReadonlyReactiveHandler extends BaseReactiveHandler {\n constructor(isShallow2 = false) {\n super(true, isShallow2);\n }\n set(target, key) {\n if (!!(process.env.NODE_ENV !== \"production\")) {\n warn(\n `Set operation on key \"${String(key)}\" failed: target is readonly.`,\n target\n );\n }\n return true;\n }\n deleteProperty(target, key) {\n if (!!(process.env.NODE_ENV !== \"production\")) {\n warn(\n `Delete operation on key \"${String(key)}\" failed: target is readonly.`,\n target\n );\n }\n return true;\n }\n}\nconst mutableHandlers = /* @__PURE__ */ new MutableReactiveHandler();\nconst readonlyHandlers = /* @__PURE__ */ new ReadonlyReactiveHandler();\nconst shallowReactiveHandlers = /* @__PURE__ */ new MutableReactiveHandler(\n true\n);\nconst shallowReadonlyHandlers = /* @__PURE__ */ new ReadonlyReactiveHandler(true);\n\nconst toShallow = (value) => value;\nconst getProto = (v) => Reflect.getPrototypeOf(v);\nfunction get(target, key, isReadonly = false, isShallow = false) {\n target = target[\"__v_raw\"];\n const rawTarget = toRaw(target);\n const rawKey = toRaw(key);\n if (!isReadonly) {\n if (hasChanged(key, rawKey)) {\n track(rawTarget, \"get\", key);\n }\n track(rawTarget, \"get\", rawKey);\n }\n const { has: has2 } = getProto(rawTarget);\n const wrap = isShallow ? toShallow : isReadonly ? toReadonly : toReactive;\n if (has2.call(rawTarget, key)) {\n return wrap(target.get(key));\n } else if (has2.call(rawTarget, rawKey)) {\n return wrap(target.get(rawKey));\n } else if (target !== rawTarget) {\n target.get(key);\n }\n}\nfunction has(key, isReadonly = false) {\n const target = this[\"__v_raw\"];\n const rawTarget = toRaw(target);\n const rawKey = toRaw(key);\n if (!isReadonly) {\n if (hasChanged(key, rawKey)) {\n track(rawTarget, \"has\", key);\n }\n track(rawTarget, \"has\", rawKey);\n }\n return key === rawKey ? target.has(key) : target.has(key) || target.has(rawKey);\n}\nfunction size(target, isReadonly = false) {\n target = target[\"__v_raw\"];\n !isReadonly && track(toRaw(target), \"iterate\", ITERATE_KEY);\n return Reflect.get(target, \"size\", target);\n}\nfunction add(value) {\n value = toRaw(value);\n const target = toRaw(this);\n const proto = getProto(target);\n const hadKey = proto.has.call(target, value);\n if (!hadKey) {\n target.add(value);\n trigger(target, \"add\", value, value);\n }\n return this;\n}\nfunction set(key, value) {\n value = toRaw(value);\n const target = toRaw(this);\n const { has: has2, get: get2 } = getProto(target);\n let hadKey = has2.call(target, key);\n if (!hadKey) {\n key = toRaw(key);\n hadKey = has2.call(target, key);\n } else if (!!(process.env.NODE_ENV !== \"production\")) {\n checkIdentityKeys(target, has2, key);\n }\n const oldValue = get2.call(target, key);\n target.set(key, value);\n if (!hadKey) {\n trigger(target, \"add\", key, value);\n } else if (hasChanged(value, oldValue)) {\n trigger(target, \"set\", key, value, oldValue);\n }\n return this;\n}\nfunction deleteEntry(key) {\n const target = toRaw(this);\n const { has: has2, get: get2 } = getProto(target);\n let hadKey = has2.call(target, key);\n if (!hadKey) {\n key = toRaw(key);\n hadKey = has2.call(target, key);\n } else if (!!(process.env.NODE_ENV !== \"production\")) {\n checkIdentityKeys(target, has2, key);\n }\n const oldValue = get2 ? get2.call(target, key) : void 0;\n const result = target.delete(key);\n if (hadKey) {\n trigger(target, \"delete\", key, void 0, oldValue);\n }\n return result;\n}\nfunction clear() {\n const target = toRaw(this);\n const hadItems = target.size !== 0;\n const oldTarget = !!(process.env.NODE_ENV !== \"production\") ? isMap(target) ? new Map(target) : new Set(target) : void 0;\n const result = target.clear();\n if (hadItems) {\n trigger(target, \"clear\", void 0, void 0, oldTarget);\n }\n return result;\n}\nfunction createForEach(isReadonly, isShallow) {\n return function forEach(callback, thisArg) {\n const observed = this;\n const target = observed[\"__v_raw\"];\n const rawTarget = toRaw(target);\n const wrap = isShallow ? toShallow : isReadonly ? toReadonly : toReactive;\n !isReadonly && track(rawTarget, \"iterate\", ITERATE_KEY);\n return target.forEach((value, key) => {\n return callback.call(thisArg, wrap(value), wrap(key), observed);\n });\n };\n}\nfunction createIterableMethod(method, isReadonly, isShallow) {\n return function(...args) {\n const target = this[\"__v_raw\"];\n const rawTarget = toRaw(target);\n const targetIsMap = isMap(rawTarget);\n const isPair = method === \"entries\" || method === Symbol.iterator && targetIsMap;\n const isKeyOnly = method === \"keys\" && targetIsMap;\n const innerIterator = target[method](...args);\n const wrap = isShallow ? toShallow : isReadonly ? toReadonly : toReactive;\n !isReadonly && track(\n rawTarget,\n \"iterate\",\n isKeyOnly ? MAP_KEY_ITERATE_KEY : ITERATE_KEY\n );\n return {\n // iterator protocol\n next() {\n const { value, done } = innerIterator.next();\n return done ? { value, done } : {\n value: isPair ? [wrap(value[0]), wrap(value[1])] : wrap(value),\n done\n };\n },\n // iterable protocol\n [Symbol.iterator]() {\n return this;\n }\n };\n };\n}\nfunction createReadonlyMethod(type) {\n return function(...args) {\n if (!!(process.env.NODE_ENV !== \"production\")) {\n const key = args[0] ? `on key \"${args[0]}\" ` : ``;\n warn(\n `${capitalize(type)} operation ${key}failed: target is readonly.`,\n toRaw(this)\n );\n }\n return type === \"delete\" ? false : type === \"clear\" ? void 0 : this;\n };\n}\nfunction createInstrumentations() {\n const mutableInstrumentations2 = {\n get(key) {\n return get(this, key);\n },\n get size() {\n return size(this);\n },\n has,\n add,\n set,\n delete: deleteEntry,\n clear,\n forEach: createForEach(false, false)\n };\n const shallowInstrumentations2 = {\n get(key) {\n return get(this, key, false, true);\n },\n get size() {\n return size(this);\n },\n has,\n add,\n set,\n delete: deleteEntry,\n clear,\n forEach: createForEach(false, true)\n };\n const readonlyInstrumentations2 = {\n get(key) {\n return get(this, key, true);\n },\n get size() {\n return size(this, true);\n },\n has(key) {\n return has.call(this, key, true);\n },\n add: createReadonlyMethod(\"add\"),\n set: createReadonlyMethod(\"set\"),\n delete: createReadonlyMethod(\"delete\"),\n clear: createReadonlyMethod(\"clear\"),\n forEach: createForEach(true, false)\n };\n const shallowReadonlyInstrumentations2 = {\n get(key) {\n return get(this, key, true, true);\n },\n get size() {\n return size(this, true);\n },\n has(key) {\n return has.call(this, key, true);\n },\n add: createReadonlyMethod(\"add\"),\n set: createReadonlyMethod(\"set\"),\n delete: createReadonlyMethod(\"delete\"),\n clear: createReadonlyMethod(\"clear\"),\n forEach: createForEach(true, true)\n };\n const iteratorMethods = [\"keys\", \"values\", \"entries\", Symbol.iterator];\n iteratorMethods.forEach((method) => {\n mutableInstrumentations2[method] = createIterableMethod(\n method,\n false,\n false\n );\n readonlyInstrumentations2[method] = createIterableMethod(\n method,\n true,\n false\n );\n shallowInstrumentations2[method] = createIterableMethod(\n method,\n false,\n true\n );\n shallowReadonlyInstrumentations2[method] = createIterableMethod(\n method,\n true,\n true\n );\n });\n return [\n mutableInstrumentations2,\n readonlyInstrumentations2,\n shallowInstrumentations2,\n shallowReadonlyInstrumentations2\n ];\n}\nconst [\n mutableInstrumentations,\n readonlyInstrumentations,\n shallowInstrumentations,\n shallowReadonlyInstrumentations\n] = /* @__PURE__ */ createInstrumentations();\nfunction createInstrumentationGetter(isReadonly, shallow) {\n const instrumentations = shallow ? isReadonly ? shallowReadonlyInstrumentations : shallowInstrumentations : isReadonly ? readonlyInstrumentations : mutableInstrumentations;\n return (target, key, receiver) => {\n if (key === \"__v_isReactive\") {\n return !isReadonly;\n } else if (key === \"__v_isReadonly\") {\n return isReadonly;\n } else if (key === \"__v_raw\") {\n return target;\n }\n return Reflect.get(\n hasOwn(instrumentations, key) && key in target ? instrumentations : target,\n key,\n receiver\n );\n };\n}\nconst mutableCollectionHandlers = {\n get: /* @__PURE__ */ createInstrumentationGetter(false, false)\n};\nconst shallowCollectionHandlers = {\n get: /* @__PURE__ */ createInstrumentationGetter(false, true)\n};\nconst readonlyCollectionHandlers = {\n get: /* @__PURE__ */ createInstrumentationGetter(true, false)\n};\nconst shallowReadonlyCollectionHandlers = {\n get: /* @__PURE__ */ createInstrumentationGetter(true, true)\n};\nfunction checkIdentityKeys(target, has2, key) {\n const rawKey = toRaw(key);\n if (rawKey !== key && has2.call(target, rawKey)) {\n const type = toRawType(target);\n warn(\n `Reactive ${type} contains both the raw and reactive versions of the same object${type === `Map` ? ` as keys` : ``}, which can lead to inconsistencies. Avoid differentiating between the raw and reactive versions of an object and only use the reactive version if possible.`\n );\n }\n}\n\nconst reactiveMap = /* @__PURE__ */ new WeakMap();\nconst shallowReactiveMap = /* @__PURE__ */ new WeakMap();\nconst readonlyMap = /* @__PURE__ */ new WeakMap();\nconst shallowReadonlyMap = /* @__PURE__ */ new WeakMap();\nfunction targetTypeMap(rawType) {\n switch (rawType) {\n case \"Object\":\n case \"Array\":\n return 1 /* COMMON */;\n case \"Map\":\n case \"Set\":\n case \"WeakMap\":\n case \"WeakSet\":\n return 2 /* COLLECTION */;\n default:\n return 0 /* INVALID */;\n }\n}\nfunction getTargetType(value) {\n return value[\"__v_skip\"] || !Object.isExtensible(value) ? 0 /* INVALID */ : targetTypeMap(toRawType(value));\n}\nfunction reactive(target) {\n if (isReadonly(target)) {\n return target;\n }\n return createReactiveObject(\n target,\n false,\n mutableHandlers,\n mutableCollectionHandlers,\n reactiveMap\n );\n}\nfunction shallowReactive(target) {\n return createReactiveObject(\n target,\n false,\n shallowReactiveHandlers,\n shallowCollectionHandlers,\n shallowReactiveMap\n );\n}\nfunction readonly(target) {\n return createReactiveObject(\n target,\n true,\n readonlyHandlers,\n readonlyCollectionHandlers,\n readonlyMap\n );\n}\nfunction shallowReadonly(target) {\n return createReactiveObject(\n target,\n true,\n shallowReadonlyHandlers,\n shallowReadonlyCollectionHandlers,\n shallowReadonlyMap\n );\n}\nfunction createReactiveObject(target, isReadonly2, baseHandlers, collectionHandlers, proxyMap) {\n if (!isObject(target)) {\n if (!!(process.env.NODE_ENV !== \"production\")) {\n warn(`value cannot be made reactive: ${String(target)}`);\n }\n return target;\n }\n if (target[\"__v_raw\"] && !(isReadonly2 && target[\"__v_isReactive\"])) {\n return target;\n }\n const existingProxy = proxyMap.get(target);\n if (existingProxy) {\n return existingProxy;\n }\n const targetType = getTargetType(target);\n if (targetType === 0 /* INVALID */) {\n return target;\n }\n const proxy = new Proxy(\n target,\n targetType === 2 /* COLLECTION */ ? collectionHandlers : baseHandlers\n );\n proxyMap.set(target, proxy);\n return proxy;\n}\nfunction isReactive(value) {\n if (isReadonly(value)) {\n return isReactive(value[\"__v_raw\"]);\n }\n return !!(value && value[\"__v_isReactive\"]);\n}\nfunction isReadonly(value) {\n return !!(value && value[\"__v_isReadonly\"]);\n}\nfunction isShallow(value) {\n return !!(value && value[\"__v_isShallow\"]);\n}\nfunction isProxy(value) {\n return isReactive(value) || isReadonly(value);\n}\nfunction toRaw(observed) {\n const raw = observed && observed[\"__v_raw\"];\n return raw ? toRaw(raw) : observed;\n}\nfunction markRaw(value) {\n if (Object.isExtensible(value)) {\n def(value, \"__v_skip\", true);\n }\n return value;\n}\nconst toReactive = (value) => isObject(value) ? reactive(value) : value;\nconst toReadonly = (value) => isObject(value) ? readonly(value) : value;\n\nconst COMPUTED_SIDE_EFFECT_WARN = `Computed is still dirty after getter evaluation, likely because a computed is mutating its own dependency in its getter. State mutations in computed getters should be avoided. Check the docs for more details: https://vuejs.org/guide/essentials/computed.html#getters-should-be-side-effect-free`;\nclass ComputedRefImpl {\n constructor(getter, _setter, isReadonly, isSSR) {\n this.getter = getter;\n this._setter = _setter;\n this.dep = void 0;\n this.__v_isRef = true;\n this[\"__v_isReadonly\"] = false;\n this.effect = new ReactiveEffect(\n () => getter(this._value),\n () => triggerRefValue(\n this,\n this.effect._dirtyLevel === 2 ? 2 : 3\n )\n );\n this.effect.computed = this;\n this.effect.active = this._cacheable = !isSSR;\n this[\"__v_isReadonly\"] = isReadonly;\n }\n get value() {\n const self = toRaw(this);\n if ((!self._cacheable || self.effect.dirty) && hasChanged(self._value, self._value = self.effect.run())) {\n triggerRefValue(self, 4);\n }\n trackRefValue(self);\n if (self.effect._dirtyLevel >= 2) {\n if (!!(process.env.NODE_ENV !== \"production\") && this._warnRecursive) {\n warn(COMPUTED_SIDE_EFFECT_WARN, `\n\ngetter: `, this.getter);\n }\n triggerRefValue(self, 2);\n }\n return self._value;\n }\n set value(newValue) {\n this._setter(newValue);\n }\n // #region polyfill _dirty for backward compatibility third party code for Vue <= 3.3.x\n get _dirty() {\n return this.effect.dirty;\n }\n set _dirty(v) {\n this.effect.dirty = v;\n }\n // #endregion\n}\nfunction computed(getterOrOptions, debugOptions, isSSR = false) {\n let getter;\n let setter;\n const onlyGetter = isFunction(getterOrOptions);\n if (onlyGetter) {\n getter = getterOrOptions;\n setter = !!(process.env.NODE_ENV !== \"production\") ? () => {\n warn(\"Write operation failed: computed value is readonly\");\n } : NOOP;\n } else {\n getter = getterOrOptions.get;\n setter = getterOrOptions.set;\n }\n const cRef = new ComputedRefImpl(getter, setter, onlyGetter || !setter, isSSR);\n if (!!(process.env.NODE_ENV !== \"production\") && debugOptions && !isSSR) {\n cRef.effect.onTrack = debugOptions.onTrack;\n cRef.effect.onTrigger = debugOptions.onTrigger;\n }\n return cRef;\n}\n\nfunction trackRefValue(ref2) {\n var _a;\n if (shouldTrack && activeEffect) {\n ref2 = toRaw(ref2);\n trackEffect(\n activeEffect,\n (_a = ref2.dep) != null ? _a : ref2.dep = createDep(\n () => ref2.dep = void 0,\n ref2 instanceof ComputedRefImpl ? ref2 : void 0\n ),\n !!(process.env.NODE_ENV !== \"production\") ? {\n target: ref2,\n type: \"get\",\n key: \"value\"\n } : void 0\n );\n }\n}\nfunction triggerRefValue(ref2, dirtyLevel = 4, newVal) {\n ref2 = toRaw(ref2);\n const dep = ref2.dep;\n if (dep) {\n triggerEffects(\n dep,\n dirtyLevel,\n !!(process.env.NODE_ENV !== \"production\") ? {\n target: ref2,\n type: \"set\",\n key: \"value\",\n newValue: newVal\n } : void 0\n );\n }\n}\nfunction isRef(r) {\n return !!(r && r.__v_isRef === true);\n}\nfunction ref(value) {\n return createRef(value, false);\n}\nfunction shallowRef(value) {\n return createRef(value, true);\n}\nfunction createRef(rawValue, shallow) {\n if (isRef(rawValue)) {\n return rawValue;\n }\n return new RefImpl(rawValue, shallow);\n}\nclass RefImpl {\n constructor(value, __v_isShallow) {\n this.__v_isShallow = __v_isShallow;\n this.dep = void 0;\n this.__v_isRef = true;\n this._rawValue = __v_isShallow ? value : toRaw(value);\n this._value = __v_isShallow ? value : toReactive(value);\n }\n get value() {\n trackRefValue(this);\n return this._value;\n }\n set value(newVal) {\n const useDirectValue = this.__v_isShallow || isShallow(newVal) || isReadonly(newVal);\n newVal = useDirectValue ? newVal : toRaw(newVal);\n if (hasChanged(newVal, this._rawValue)) {\n this._rawValue = newVal;\n this._value = useDirectValue ? newVal : toReactive(newVal);\n triggerRefValue(this, 4, newVal);\n }\n }\n}\nfunction triggerRef(ref2) {\n triggerRefValue(ref2, 4, !!(process.env.NODE_ENV !== \"production\") ? ref2.value : void 0);\n}\nfunction unref(ref2) {\n return isRef(ref2) ? ref2.value : ref2;\n}\nfunction toValue(source) {\n return isFunction(source) ? source() : unref(source);\n}\nconst shallowUnwrapHandlers = {\n get: (target, key, receiver) => unref(Reflect.get(target, key, receiver)),\n set: (target, key, value, receiver) => {\n const oldValue = target[key];\n if (isRef(oldValue) && !isRef(value)) {\n oldValue.value = value;\n return true;\n } else {\n return Reflect.set(target, key, value, receiver);\n }\n }\n};\nfunction proxyRefs(objectWithRefs) {\n return isReactive(objectWithRefs) ? objectWithRefs : new Proxy(objectWithRefs, shallowUnwrapHandlers);\n}\nclass CustomRefImpl {\n constructor(factory) {\n this.dep = void 0;\n this.__v_isRef = true;\n const { get, set } = factory(\n () => trackRefValue(this),\n () => triggerRefValue(this)\n );\n this._get = get;\n this._set = set;\n }\n get value() {\n return this._get();\n }\n set value(newVal) {\n this._set(newVal);\n }\n}\nfunction customRef(factory) {\n return new CustomRefImpl(factory);\n}\nfunction toRefs(object) {\n if (!!(process.env.NODE_ENV !== \"production\") && !isProxy(object)) {\n warn(`toRefs() expects a reactive object but received a plain one.`);\n }\n const ret = isArray(object) ? new Array(object.length) : {};\n for (const key in object) {\n ret[key] = propertyToRef(object, key);\n }\n return ret;\n}\nclass ObjectRefImpl {\n constructor(_object, _key, _defaultValue) {\n this._object = _object;\n this._key = _key;\n this._defaultValue = _defaultValue;\n this.__v_isRef = true;\n }\n get value() {\n const val = this._object[this._key];\n return val === void 0 ? this._defaultValue : val;\n }\n set value(newVal) {\n this._object[this._key] = newVal;\n }\n get dep() {\n return getDepFromReactive(toRaw(this._object), this._key);\n }\n}\nclass GetterRefImpl {\n constructor(_getter) {\n this._getter = _getter;\n this.__v_isRef = true;\n this.__v_isReadonly = true;\n }\n get value() {\n return this._getter();\n }\n}\nfunction toRef(source, key, defaultValue) {\n if (isRef(source)) {\n return source;\n } else if (isFunction(source)) {\n return new GetterRefImpl(source);\n } else if (isObject(source) && arguments.length > 1) {\n return propertyToRef(source, key, defaultValue);\n } else {\n return ref(source);\n }\n}\nfunction propertyToRef(source, key, defaultValue) {\n const val = source[key];\n return isRef(val) ? val : new ObjectRefImpl(source, key, defaultValue);\n}\n\nconst deferredComputed = computed;\n\nconst TrackOpTypes = {\n \"GET\": \"get\",\n \"HAS\": \"has\",\n \"ITERATE\": \"iterate\"\n};\nconst TriggerOpTypes = {\n \"SET\": \"set\",\n \"ADD\": \"add\",\n \"DELETE\": \"delete\",\n \"CLEAR\": \"clear\"\n};\nconst ReactiveFlags = {\n \"SKIP\": \"__v_skip\",\n \"IS_REACTIVE\": \"__v_isReactive\",\n \"IS_READONLY\": \"__v_isReadonly\",\n \"IS_SHALLOW\": \"__v_isShallow\",\n \"RAW\": \"__v_raw\"\n};\n\nexport { EffectScope, ITERATE_KEY, ReactiveEffect, ReactiveFlags, TrackOpTypes, TriggerOpTypes, computed, customRef, deferredComputed, effect, effectScope, enableTracking, getCurrentScope, isProxy, isReactive, isReadonly, isRef, isShallow, markRaw, onScopeDispose, pauseScheduling, pauseTracking, proxyRefs, reactive, readonly, ref, resetScheduling, resetTracking, shallowReactive, shallowReadonly, shallowRef, stop, toRaw, toRef, toRefs, toValue, track, trigger, triggerRef, unref };\n","/**\n* @vue/runtime-core v3.4.21\n* (c) 2018-present Yuxi (Evan) You and Vue contributors\n* @license MIT\n**/\nimport { pauseTracking, resetTracking, isRef, toRaw, isShallow, isReactive, ReactiveEffect, getCurrentScope, ref, shallowReadonly, track, reactive, shallowReactive, trigger, isProxy, proxyRefs, markRaw, EffectScope, computed as computed$1, customRef, isReadonly } from '@vue/reactivity';\nexport { EffectScope, ReactiveEffect, TrackOpTypes, TriggerOpTypes, customRef, effect, effectScope, getCurrentScope, isProxy, isReactive, isReadonly, isRef, isShallow, markRaw, onScopeDispose, proxyRefs, reactive, readonly, ref, shallowReactive, shallowReadonly, shallowRef, stop, toRaw, toRef, toRefs, toValue, triggerRef, unref } from '@vue/reactivity';\nimport { isString, isFunction, isPromise, isArray, NOOP, getGlobalThis, extend, EMPTY_OBJ, toHandlerKey, looseToNumber, hyphenate, camelize, isObject, isOn, hasOwn, isModelListener, capitalize, toNumber, hasChanged, remove, isSet, isMap, isPlainObject, isBuiltInDirective, invokeArrayFns, isRegExp, isGloballyAllowed, NO, def, isReservedProp, EMPTY_ARR, toRawType, makeMap, normalizeClass, stringifyStyle, normalizeStyle, isKnownSvgAttr, isBooleanAttr, isKnownHtmlAttr, includeBooleanAttr, isRenderableAttrValue } from '@vue/shared';\nexport { camelize, capitalize, normalizeClass, normalizeProps, normalizeStyle, toDisplayString, toHandlerKey } from '@vue/shared';\n\nconst stack = [];\nfunction pushWarningContext(vnode) {\n stack.push(vnode);\n}\nfunction popWarningContext() {\n stack.pop();\n}\nfunction warn$1(msg, ...args) {\n pauseTracking();\n const instance = stack.length ? stack[stack.length - 1].component : null;\n const appWarnHandler = instance && instance.appContext.config.warnHandler;\n const trace = getComponentTrace();\n if (appWarnHandler) {\n callWithErrorHandling(\n appWarnHandler,\n instance,\n 11,\n [\n msg + args.map((a) => {\n var _a, _b;\n return (_b = (_a = a.toString) == null ? void 0 : _a.call(a)) != null ? _b : JSON.stringify(a);\n }).join(\"\"),\n instance && instance.proxy,\n trace.map(\n ({ vnode }) => `at <${formatComponentName(instance, vnode.type)}>`\n ).join(\"\\n\"),\n trace\n ]\n );\n } else {\n const warnArgs = [`[Vue warn]: ${msg}`, ...args];\n if (trace.length && // avoid spamming console during tests\n true) {\n warnArgs.push(`\n`, ...formatTrace(trace));\n }\n console.warn(...warnArgs);\n }\n resetTracking();\n}\nfunction getComponentTrace() {\n let currentVNode = stack[stack.length - 1];\n if (!currentVNode) {\n return [];\n }\n const normalizedStack = [];\n while (currentVNode) {\n const last = normalizedStack[0];\n if (last && last.vnode === currentVNode) {\n last.recurseCount++;\n } else {\n normalizedStack.push({\n vnode: currentVNode,\n recurseCount: 0\n });\n }\n const parentInstance = currentVNode.component && currentVNode.component.parent;\n currentVNode = parentInstance && parentInstance.vnode;\n }\n return normalizedStack;\n}\nfunction formatTrace(trace) {\n const logs = [];\n trace.forEach((entry, i) => {\n logs.push(...i === 0 ? [] : [`\n`], ...formatTraceEntry(entry));\n });\n return logs;\n}\nfunction formatTraceEntry({ vnode, recurseCount }) {\n const postfix = recurseCount > 0 ? `... (${recurseCount} recursive calls)` : ``;\n const isRoot = vnode.component ? vnode.component.parent == null : false;\n const open = ` at <${formatComponentName(\n vnode.component,\n vnode.type,\n isRoot\n )}`;\n const close = `>` + postfix;\n return vnode.props ? [open, ...formatProps(vnode.props), close] : [open + close];\n}\nfunction formatProps(props) {\n const res = [];\n const keys = Object.keys(props);\n keys.slice(0, 3).forEach((key) => {\n res.push(...formatProp(key, props[key]));\n });\n if (keys.length > 3) {\n res.push(` ...`);\n }\n return res;\n}\nfunction formatProp(key, value, raw) {\n if (isString(value)) {\n value = JSON.stringify(value);\n return raw ? value : [`${key}=${value}`];\n } else if (typeof value === \"number\" || typeof value === \"boolean\" || value == null) {\n return raw ? value : [`${key}=${value}`];\n } else if (isRef(value)) {\n value = formatProp(key, toRaw(value.value), true);\n return raw ? value : [`${key}=Ref<`, value, `>`];\n } else if (isFunction(value)) {\n return [`${key}=fn${value.name ? `<${value.name}>` : ``}`];\n } else {\n value = toRaw(value);\n return raw ? value : [`${key}=`, value];\n }\n}\nfunction assertNumber(val, type) {\n if (!!!(process.env.NODE_ENV !== \"production\"))\n return;\n if (val === void 0) {\n return;\n } else if (typeof val !== \"number\") {\n warn$1(`${type} is not a valid number - got ${JSON.stringify(val)}.`);\n } else if (isNaN(val)) {\n warn$1(`${type} is NaN - the duration expression might be incorrect.`);\n }\n}\n\nconst ErrorCodes = {\n \"SETUP_FUNCTION\": 0,\n \"0\": \"SETUP_FUNCTION\",\n \"RENDER_FUNCTION\": 1,\n \"1\": \"RENDER_FUNCTION\",\n \"WATCH_GETTER\": 2,\n \"2\": \"WATCH_GETTER\",\n \"WATCH_CALLBACK\": 3,\n \"3\": \"WATCH_CALLBACK\",\n \"WATCH_CLEANUP\": 4,\n \"4\": \"WATCH_CLEANUP\",\n \"NATIVE_EVENT_HANDLER\": 5,\n \"5\": \"NATIVE_EVENT_HANDLER\",\n \"COMPONENT_EVENT_HANDLER\": 6,\n \"6\": \"COMPONENT_EVENT_HANDLER\",\n \"VNODE_HOOK\": 7,\n \"7\": \"VNODE_HOOK\",\n \"DIRECTIVE_HOOK\": 8,\n \"8\": \"DIRECTIVE_HOOK\",\n \"TRANSITION_HOOK\": 9,\n \"9\": \"TRANSITION_HOOK\",\n \"APP_ERROR_HANDLER\": 10,\n \"10\": \"APP_ERROR_HANDLER\",\n \"APP_WARN_HANDLER\": 11,\n \"11\": \"APP_WARN_HANDLER\",\n \"FUNCTION_REF\": 12,\n \"12\": \"FUNCTION_REF\",\n \"ASYNC_COMPONENT_LOADER\": 13,\n \"13\": \"ASYNC_COMPONENT_LOADER\",\n \"SCHEDULER\": 14,\n \"14\": \"SCHEDULER\"\n};\nconst ErrorTypeStrings$1 = {\n [\"sp\"]: \"serverPrefetch hook\",\n [\"bc\"]: \"beforeCreate hook\",\n [\"c\"]: \"created hook\",\n [\"bm\"]: \"beforeMount hook\",\n [\"m\"]: \"mounted hook\",\n [\"bu\"]: \"beforeUpdate hook\",\n [\"u\"]: \"updated\",\n [\"bum\"]: \"beforeUnmount hook\",\n [\"um\"]: \"unmounted hook\",\n [\"a\"]: \"activated hook\",\n [\"da\"]: \"deactivated hook\",\n [\"ec\"]: \"errorCaptured hook\",\n [\"rtc\"]: \"renderTracked hook\",\n [\"rtg\"]: \"renderTriggered hook\",\n [0]: \"setup function\",\n [1]: \"render function\",\n [2]: \"watcher getter\",\n [3]: \"watcher callback\",\n [4]: \"watcher cleanup function\",\n [5]: \"native event handler\",\n [6]: \"component event handler\",\n [7]: \"vnode hook\",\n [8]: \"directive hook\",\n [9]: \"transition hook\",\n [10]: \"app errorHandler\",\n [11]: \"app warnHandler\",\n [12]: \"ref function\",\n [13]: \"async component loader\",\n [14]: \"scheduler flush. This is likely a Vue internals bug. Please open an issue at https://github.com/vuejs/core .\"\n};\nfunction callWithErrorHandling(fn, instance, type, args) {\n try {\n return args ? fn(...args) : fn();\n } catch (err) {\n handleError(err, instance, type);\n }\n}\nfunction callWithAsyncErrorHandling(fn, instance, type, args) {\n if (isFunction(fn)) {\n const res = callWithErrorHandling(fn, instance, type, args);\n if (res && isPromise(res)) {\n res.catch((err) => {\n handleError(err, instance, type);\n });\n }\n return res;\n }\n const values = [];\n for (let i = 0; i < fn.length; i++) {\n values.push(callWithAsyncErrorHandling(fn[i], instance, type, args));\n }\n return values;\n}\nfunction handleError(err, instance, type, throwInDev = true) {\n const contextVNode = instance ? instance.vnode : null;\n if (instance) {\n let cur = instance.parent;\n const exposedInstance = instance.proxy;\n const errorInfo = !!(process.env.NODE_ENV !== \"production\") ? ErrorTypeStrings$1[type] : `https://vuejs.org/error-reference/#runtime-${type}`;\n while (cur) {\n const errorCapturedHooks = cur.ec;\n if (errorCapturedHooks) {\n for (let i = 0; i < errorCapturedHooks.length; i++) {\n if (errorCapturedHooks[i](err, exposedInstance, errorInfo) === false) {\n return;\n }\n }\n }\n cur = cur.parent;\n }\n const appErrorHandler = instance.appContext.config.errorHandler;\n if (appErrorHandler) {\n callWithErrorHandling(\n appErrorHandler,\n null,\n 10,\n [err, exposedInstance, errorInfo]\n );\n return;\n }\n }\n logError(err, type, contextVNode, throwInDev);\n}\nfunction logError(err, type, contextVNode, throwInDev = true) {\n if (!!(process.env.NODE_ENV !== \"production\")) {\n const info = ErrorTypeStrings$1[type];\n if (contextVNode) {\n pushWarningContext(contextVNode);\n }\n warn$1(`Unhandled error${info ? ` during execution of ${info}` : ``}`);\n if (contextVNode) {\n popWarningContext();\n }\n if (throwInDev) {\n throw err;\n } else {\n console.error(err);\n }\n } else {\n console.error(err);\n }\n}\n\nlet isFlushing = false;\nlet isFlushPending = false;\nconst queue = [];\nlet flushIndex = 0;\nconst pendingPostFlushCbs = [];\nlet activePostFlushCbs = null;\nlet postFlushIndex = 0;\nconst resolvedPromise = /* @__PURE__ */ Promise.resolve();\nlet currentFlushPromise = null;\nconst RECURSION_LIMIT = 100;\nfunction nextTick(fn) {\n const p = currentFlushPromise || resolvedPromise;\n return fn ? p.then(this ? fn.bind(this) : fn) : p;\n}\nfunction findInsertionIndex(id) {\n let start = flushIndex + 1;\n let end = queue.length;\n while (start < end) {\n const middle = start + end >>> 1;\n const middleJob = queue[middle];\n const middleJobId = getId(middleJob);\n if (middleJobId < id || middleJobId === id && middleJob.pre) {\n start = middle + 1;\n } else {\n end = middle;\n }\n }\n return start;\n}\nfunction queueJob(job) {\n if (!queue.length || !queue.includes(\n job,\n isFlushing && job.allowRecurse ? flushIndex + 1 : flushIndex\n )) {\n if (job.id == null) {\n queue.push(job);\n } else {\n queue.splice(findInsertionIndex(job.id), 0, job);\n }\n queueFlush();\n }\n}\nfunction queueFlush() {\n if (!isFlushing && !isFlushPending) {\n isFlushPending = true;\n currentFlushPromise = resolvedPromise.then(flushJobs);\n }\n}\nfunction invalidateJob(job) {\n const i = queue.indexOf(job);\n if (i > flushIndex) {\n queue.splice(i, 1);\n }\n}\nfunction queuePostFlushCb(cb) {\n if (!isArray(cb)) {\n if (!activePostFlushCbs || !activePostFlushCbs.includes(\n cb,\n cb.allowRecurse ? postFlushIndex + 1 : postFlushIndex\n )) {\n pendingPostFlushCbs.push(cb);\n }\n } else {\n pendingPostFlushCbs.push(...cb);\n }\n queueFlush();\n}\nfunction flushPreFlushCbs(instance, seen, i = isFlushing ? flushIndex + 1 : 0) {\n if (!!(process.env.NODE_ENV !== \"production\")) {\n seen = seen || /* @__PURE__ */ new Map();\n }\n for (; i < queue.length; i++) {\n const cb = queue[i];\n if (cb && cb.pre) {\n if (instance && cb.id !== instance.uid) {\n continue;\n }\n if (!!(process.env.NODE_ENV !== \"production\") && checkRecursiveUpdates(seen, cb)) {\n continue;\n }\n queue.splice(i, 1);\n i--;\n cb();\n }\n }\n}\nfunction flushPostFlushCbs(seen) {\n if (pendingPostFlushCbs.length) {\n const deduped = [...new Set(pendingPostFlushCbs)].sort(\n (a, b) => getId(a) - getId(b)\n );\n pendingPostFlushCbs.length = 0;\n if (activePostFlushCbs) {\n activePostFlushCbs.push(...deduped);\n return;\n }\n activePostFlushCbs = deduped;\n if (!!(process.env.NODE_ENV !== \"production\")) {\n seen = seen || /* @__PURE__ */ new Map();\n }\n for (postFlushIndex = 0; postFlushIndex < activePostFlushCbs.length; postFlushIndex++) {\n if (!!(process.env.NODE_ENV !== \"production\") && checkRecursiveUpdates(seen, activePostFlushCbs[postFlushIndex])) {\n continue;\n }\n activePostFlushCbs[postFlushIndex]();\n }\n activePostFlushCbs = null;\n postFlushIndex = 0;\n }\n}\nconst getId = (job) => job.id == null ? Infinity : job.id;\nconst comparator = (a, b) => {\n const diff = getId(a) - getId(b);\n if (diff === 0) {\n if (a.pre && !b.pre)\n return -1;\n if (b.pre && !a.pre)\n return 1;\n }\n return diff;\n};\nfunction flushJobs(seen) {\n isFlushPending = false;\n isFlushing = true;\n if (!!(process.env.NODE_ENV !== \"production\")) {\n seen = seen || /* @__PURE__ */ new Map();\n }\n queue.sort(comparator);\n const check = !!(process.env.NODE_ENV !== \"production\") ? (job) => checkRecursiveUpdates(seen, job) : NOOP;\n try {\n for (flushIndex = 0; flushIndex < queue.length; flushIndex++) {\n const job = queue[flushIndex];\n if (job && job.active !== false) {\n if (!!(process.env.NODE_ENV !== \"production\") && check(job)) {\n continue;\n }\n callWithErrorHandling(job, null, 14);\n }\n }\n } finally {\n flushIndex = 0;\n queue.length = 0;\n flushPostFlushCbs(seen);\n isFlushing = false;\n currentFlushPromise = null;\n if (queue.length || pendingPostFlushCbs.length) {\n flushJobs(seen);\n }\n }\n}\nfunction checkRecursiveUpdates(seen, fn) {\n if (!seen.has(fn)) {\n seen.set(fn, 1);\n } else {\n const count = seen.get(fn);\n if (count > RECURSION_LIMIT) {\n const instance = fn.ownerInstance;\n const componentName = instance && getComponentName(instance.type);\n handleError(\n `Maximum recursive updates exceeded${componentName ? ` in component <${componentName}>` : ``}. This means you have a reactive effect that is mutating its own dependencies and thus recursively triggering itself. Possible sources include component template, render function, updated hook or watcher source function.`,\n null,\n 10\n );\n return true;\n } else {\n seen.set(fn, count + 1);\n }\n }\n}\n\nlet isHmrUpdating = false;\nconst hmrDirtyComponents = /* @__PURE__ */ new Set();\nif (!!(process.env.NODE_ENV !== \"production\")) {\n getGlobalThis().__VUE_HMR_RUNTIME__ = {\n createRecord: tryWrap(createRecord),\n rerender: tryWrap(rerender),\n reload: tryWrap(reload)\n };\n}\nconst map = /* @__PURE__ */ new Map();\nfunction registerHMR(instance) {\n const id = instance.type.__hmrId;\n let record = map.get(id);\n if (!record) {\n createRecord(id, instance.type);\n record = map.get(id);\n }\n record.instances.add(instance);\n}\nfunction unregisterHMR(instance) {\n map.get(instance.type.__hmrId).instances.delete(instance);\n}\nfunction createRecord(id, initialDef) {\n if (map.has(id)) {\n return false;\n }\n map.set(id, {\n initialDef: normalizeClassComponent(initialDef),\n instances: /* @__PURE__ */ new Set()\n });\n return true;\n}\nfunction normalizeClassComponent(component) {\n return isClassComponent(component) ? component.__vccOpts : component;\n}\nfunction rerender(id, newRender) {\n const record = map.get(id);\n if (!record) {\n return;\n }\n record.initialDef.render = newRender;\n [...record.instances].forEach((instance) => {\n if (newRender) {\n instance.render = newRender;\n normalizeClassComponent(instance.type).render = newRender;\n }\n instance.renderCache = [];\n isHmrUpdating = true;\n instance.effect.dirty = true;\n instance.update();\n isHmrUpdating = false;\n });\n}\nfunction reload(id, newComp) {\n const record = map.get(id);\n if (!record)\n return;\n newComp = normalizeClassComponent(newComp);\n updateComponentDef(record.initialDef, newComp);\n const instances = [...record.instances];\n for (const instance of instances) {\n const oldComp = normalizeClassComponent(instance.type);\n if (!hmrDirtyComponents.has(oldComp)) {\n if (oldComp !== record.initialDef) {\n updateComponentDef(oldComp, newComp);\n }\n hmrDirtyComponents.add(oldComp);\n }\n instance.appContext.propsCache.delete(instance.type);\n instance.appContext.emitsCache.delete(instance.type);\n instance.appContext.optionsCache.delete(instance.type);\n if (instance.ceReload) {\n hmrDirtyComponents.add(oldComp);\n instance.ceReload(newComp.styles);\n hmrDirtyComponents.delete(oldComp);\n } else if (instance.parent) {\n instance.parent.effect.dirty = true;\n queueJob(instance.parent.update);\n } else if (instance.appContext.reload) {\n instance.appContext.reload();\n } else if (typeof window !== \"undefined\") {\n window.location.reload();\n } else {\n console.warn(\n \"[HMR] Root or manually mounted instance modified. Full reload required.\"\n );\n }\n }\n queuePostFlushCb(() => {\n for (const instance of instances) {\n hmrDirtyComponents.delete(\n normalizeClassComponent(instance.type)\n );\n }\n });\n}\nfunction updateComponentDef(oldComp, newComp) {\n extend(oldComp, newComp);\n for (const key in oldComp) {\n if (key !== \"__file\" && !(key in newComp)) {\n delete oldComp[key];\n }\n }\n}\nfunction tryWrap(fn) {\n return (id, arg) => {\n try {\n return fn(id, arg);\n } catch (e) {\n console.error(e);\n console.warn(\n `[HMR] Something went wrong during Vue component hot-reload. Full reload required.`\n );\n }\n };\n}\n\nlet devtools$1;\nlet buffer = [];\nlet devtoolsNotInstalled = false;\nfunction emit$1(event, ...args) {\n if (devtools$1) {\n devtools$1.emit(event, ...args);\n } else if (!devtoolsNotInstalled) {\n buffer.push({ event, args });\n }\n}\nfunction setDevtoolsHook$1(hook, target) {\n var _a, _b;\n devtools$1 = hook;\n if (devtools$1) {\n devtools$1.enabled = true;\n buffer.forEach(({ event, args }) => devtools$1.emit(event, ...args));\n buffer = [];\n } else if (\n // handle late devtools injection - only do this if we are in an actual\n // browser environment to avoid the timer handle stalling test runner exit\n // (#4815)\n typeof window !== \"undefined\" && // some envs mock window but not fully\n window.HTMLElement && // also exclude jsdom\n !((_b = (_a = window.navigator) == null ? void 0 : _a.userAgent) == null ? void 0 : _b.includes(\"jsdom\"))\n ) {\n const replay = target.__VUE_DEVTOOLS_HOOK_REPLAY__ = target.__VUE_DEVTOOLS_HOOK_REPLAY__ || [];\n replay.push((newHook) => {\n setDevtoolsHook$1(newHook, target);\n });\n setTimeout(() => {\n if (!devtools$1) {\n target.__VUE_DEVTOOLS_HOOK_REPLAY__ = null;\n devtoolsNotInstalled = true;\n buffer = [];\n }\n }, 3e3);\n } else {\n devtoolsNotInstalled = true;\n buffer = [];\n }\n}\nfunction devtoolsInitApp(app, version) {\n emit$1(\"app:init\" /* APP_INIT */, app, version, {\n Fragment,\n Text,\n Comment,\n Static\n });\n}\nfunction devtoolsUnmountApp(app) {\n emit$1(\"app:unmount\" /* APP_UNMOUNT */, app);\n}\nconst devtoolsComponentAdded = /* @__PURE__ */ createDevtoolsComponentHook(\n \"component:added\" /* COMPONENT_ADDED */\n);\nconst devtoolsComponentUpdated = /* @__PURE__ */ createDevtoolsComponentHook(\"component:updated\" /* COMPONENT_UPDATED */);\nconst _devtoolsComponentRemoved = /* @__PURE__ */ createDevtoolsComponentHook(\n \"component:removed\" /* COMPONENT_REMOVED */\n);\nconst devtoolsComponentRemoved = (component) => {\n if (devtools$1 && typeof devtools$1.cleanupBuffer === \"function\" && // remove the component if it wasn't buffered\n !devtools$1.cleanupBuffer(component)) {\n _devtoolsComponentRemoved(component);\n }\n};\nfunction createDevtoolsComponentHook(hook) {\n return (component) => {\n emit$1(\n hook,\n component.appContext.app,\n component.uid,\n component.parent ? component.parent.uid : void 0,\n component\n );\n };\n}\nconst devtoolsPerfStart = /* @__PURE__ */ createDevtoolsPerformanceHook(\n \"perf:start\" /* PERFORMANCE_START */\n);\nconst devtoolsPerfEnd = /* @__PURE__ */ createDevtoolsPerformanceHook(\n \"perf:end\" /* PERFORMANCE_END */\n);\nfunction createDevtoolsPerformanceHook(hook) {\n return (component, type, time) => {\n emit$1(hook, component.appContext.app, component.uid, component, type, time);\n };\n}\nfunction devtoolsComponentEmit(component, event, params) {\n emit$1(\n \"component:emit\" /* COMPONENT_EMIT */,\n component.appContext.app,\n component,\n event,\n params\n );\n}\n\nfunction emit(instance, event, ...rawArgs) {\n if (instance.isUnmounted)\n return;\n const props = instance.vnode.props || EMPTY_OBJ;\n if (!!(process.env.NODE_ENV !== \"production\")) {\n const {\n emitsOptions,\n propsOptions: [propsOptions]\n } = instance;\n if (emitsOptions) {\n if (!(event in emitsOptions) && true) {\n if (!propsOptions || !(toHandlerKey(event) in propsOptions)) {\n warn$1(\n `Component emitted event \"${event}\" but it is neither declared in the emits option nor as an \"${toHandlerKey(event)}\" prop.`\n );\n }\n } else {\n const validator = emitsOptions[event];\n if (isFunction(validator)) {\n const isValid = validator(...rawArgs);\n if (!isValid) {\n warn$1(\n `Invalid event arguments: event validation failed for event \"${event}\".`\n );\n }\n }\n }\n }\n }\n let args = rawArgs;\n const isModelListener = event.startsWith(\"update:\");\n const modelArg = isModelListener && event.slice(7);\n if (modelArg && modelArg in props) {\n const modifiersKey = `${modelArg === \"modelValue\" ? \"model\" : modelArg}Modifiers`;\n const { number, trim } = props[modifiersKey] || EMPTY_OBJ;\n if (trim) {\n args = rawArgs.map((a) => isString(a) ? a.trim() : a);\n }\n if (number) {\n args = rawArgs.map(looseToNumber);\n }\n }\n if (!!(process.env.NODE_ENV !== \"production\") || __VUE_PROD_DEVTOOLS__) {\n devtoolsComponentEmit(instance, event, args);\n }\n if (!!(process.env.NODE_ENV !== \"production\")) {\n const lowerCaseEvent = event.toLowerCase();\n if (lowerCaseEvent !== event && props[toHandlerKey(lowerCaseEvent)]) {\n warn$1(\n `Event \"${lowerCaseEvent}\" is emitted in component ${formatComponentName(\n instance,\n instance.type\n )} but the handler is registered for \"${event}\". Note that HTML attributes are case-insensitive and you cannot use v-on to listen to camelCase events when using in-DOM templates. You should probably use \"${hyphenate(\n event\n )}\" instead of \"${event}\".`\n );\n }\n }\n let handlerName;\n let handler = props[handlerName = toHandlerKey(event)] || // also try camelCase event handler (#2249)\n props[handlerName = toHandlerKey(camelize(event))];\n if (!handler && isModelListener) {\n handler = props[handlerName = toHandlerKey(hyphenate(event))];\n }\n if (handler) {\n callWithAsyncErrorHandling(\n handler,\n instance,\n 6,\n args\n );\n }\n const onceHandler = props[handlerName + `Once`];\n if (onceHandler) {\n if (!instance.emitted) {\n instance.emitted = {};\n } else if (instance.emitted[handlerName]) {\n return;\n }\n instance.emitted[handlerName] = true;\n callWithAsyncErrorHandling(\n onceHandler,\n instance,\n 6,\n args\n );\n }\n}\nfunction normalizeEmitsOptions(comp, appContext, asMixin = false) {\n const cache = appContext.emitsCache;\n const cached = cache.get(comp);\n if (cached !== void 0) {\n return cached;\n }\n const raw = comp.emits;\n let normalized = {};\n let hasExtends = false;\n if (__VUE_OPTIONS_API__ && !isFunction(comp)) {\n const extendEmits = (raw2) => {\n const normalizedFromExtend = normalizeEmitsOptions(raw2, appContext, true);\n if (normalizedFromExtend) {\n hasExtends = true;\n extend(normalized, normalizedFromExtend);\n }\n };\n if (!asMixin && appContext.mixins.length) {\n appContext.mixins.forEach(extendEmits);\n }\n if (comp.extends) {\n extendEmits(comp.extends);\n }\n if (comp.mixins) {\n comp.mixins.forEach(extendEmits);\n }\n }\n if (!raw && !hasExtends) {\n if (isObject(comp)) {\n cache.set(comp, null);\n }\n return null;\n }\n if (isArray(raw)) {\n raw.forEach((key) => normalized[key] = null);\n } else {\n extend(normalized, raw);\n }\n if (isObject(comp)) {\n cache.set(comp, normalized);\n }\n return normalized;\n}\nfunction isEmitListener(options, key) {\n if (!options || !isOn(key)) {\n return false;\n }\n key = key.slice(2).replace(/Once$/, \"\");\n return hasOwn(options, key[0].toLowerCase() + key.slice(1)) || hasOwn(options, hyphenate(key)) || hasOwn(options, key);\n}\n\nlet currentRenderingInstance = null;\nlet currentScopeId = null;\nfunction setCurrentRenderingInstance(instance) {\n const prev = currentRenderingInstance;\n currentRenderingInstance = instance;\n currentScopeId = instance && instance.type.__scopeId || null;\n return prev;\n}\nfunction pushScopeId(id) {\n currentScopeId = id;\n}\nfunction popScopeId() {\n currentScopeId = null;\n}\nconst withScopeId = (_id) => withCtx;\nfunction withCtx(fn, ctx = currentRenderingInstance, isNonScopedSlot) {\n if (!ctx)\n return fn;\n if (fn._n) {\n return fn;\n }\n const renderFnWithContext = (...args) => {\n if (renderFnWithContext._d) {\n setBlockTracking(-1);\n }\n const prevInstance = setCurrentRenderingInstance(ctx);\n let res;\n try {\n res = fn(...args);\n } finally {\n setCurrentRenderingInstance(prevInstance);\n if (renderFnWithContext._d) {\n setBlockTracking(1);\n }\n }\n if (!!(process.env.NODE_ENV !== \"production\") || __VUE_PROD_DEVTOOLS__) {\n devtoolsComponentUpdated(ctx);\n }\n return res;\n };\n renderFnWithContext._n = true;\n renderFnWithContext._c = true;\n renderFnWithContext._d = true;\n return renderFnWithContext;\n}\n\nlet accessedAttrs = false;\nfunction markAttrsAccessed() {\n accessedAttrs = true;\n}\nfunction renderComponentRoot(instance) {\n const {\n type: Component,\n vnode,\n proxy,\n withProxy,\n props,\n propsOptions: [propsOptions],\n slots,\n attrs,\n emit,\n render,\n renderCache,\n data,\n setupState,\n ctx,\n inheritAttrs\n } = instance;\n let result;\n let fallthroughAttrs;\n const prev = setCurrentRenderingInstance(instance);\n if (!!(process.env.NODE_ENV !== \"production\")) {\n accessedAttrs = false;\n }\n try {\n if (vnode.shapeFlag & 4) {\n const proxyToUse = withProxy || proxy;\n const thisProxy = !!(process.env.NODE_ENV !== \"production\") && setupState.__isScriptSetup ? new Proxy(proxyToUse, {\n get(target, key, receiver) {\n warn$1(\n `Property '${String(\n key\n )}' was accessed via 'this'. Avoid using 'this' in templates.`\n );\n return Reflect.get(target, key, receiver);\n }\n }) : proxyToUse;\n result = normalizeVNode(\n render.call(\n thisProxy,\n proxyToUse,\n renderCache,\n props,\n setupState,\n data,\n ctx\n )\n );\n fallthroughAttrs = attrs;\n } else {\n const render2 = Component;\n if (!!(process.env.NODE_ENV !== \"production\") && attrs === props) {\n markAttrsAccessed();\n }\n result = normalizeVNode(\n render2.length > 1 ? render2(\n props,\n !!(process.env.NODE_ENV !== \"production\") ? {\n get attrs() {\n markAttrsAccessed();\n return attrs;\n },\n slots,\n emit\n } : { attrs, slots, emit }\n ) : render2(\n props,\n null\n /* we know it doesn't need it */\n )\n );\n fallthroughAttrs = Component.props ? attrs : getFunctionalFallthrough(attrs);\n }\n } catch (err) {\n blockStack.length = 0;\n handleError(err, instance, 1);\n result = createVNode(Comment);\n }\n let root = result;\n let setRoot = void 0;\n if (!!(process.env.NODE_ENV !== \"production\") && result.patchFlag > 0 && result.patchFlag & 2048) {\n [root, setRoot] = getChildRoot(result);\n }\n if (fallthroughAttrs && inheritAttrs !== false) {\n const keys = Object.keys(fallthroughAttrs);\n const { shapeFlag } = root;\n if (keys.length) {\n if (shapeFlag & (1 | 6)) {\n if (propsOptions && keys.some(isModelListener)) {\n fallthroughAttrs = filterModelListeners(\n fallthroughAttrs,\n propsOptions\n );\n }\n root = cloneVNode(root, fallthroughAttrs);\n } else if (!!(process.env.NODE_ENV !== \"production\") && !accessedAttrs && root.type !== Comment) {\n const allAttrs = Object.keys(attrs);\n const eventAttrs = [];\n const extraAttrs = [];\n for (let i = 0, l = allAttrs.length; i < l; i++) {\n const key = allAttrs[i];\n if (isOn(key)) {\n if (!isModelListener(key)) {\n eventAttrs.push(key[2].toLowerCase() + key.slice(3));\n }\n } else {\n extraAttrs.push(key);\n }\n }\n if (extraAttrs.length) {\n warn$1(\n `Extraneous non-props attributes (${extraAttrs.join(\", \")}) were passed to component but could not be automatically inherited because component renders fragment or text root nodes.`\n );\n }\n if (eventAttrs.length) {\n warn$1(\n `Extraneous non-emits event listeners (${eventAttrs.join(\", \")}) were passed to component but could not be automatically inherited because component renders fragment or text root nodes. If the listener is intended to be a component custom event listener only, declare it using the \"emits\" option.`\n );\n }\n }\n }\n }\n if (vnode.dirs) {\n if (!!(process.env.NODE_ENV !== \"production\") && !isElementRoot(root)) {\n warn$1(\n `Runtime directive used on component with non-element root node. The directives will not function as intended.`\n );\n }\n root = cloneVNode(root);\n root.dirs = root.dirs ? root.dirs.concat(vnode.dirs) : vnode.dirs;\n }\n if (vnode.transition) {\n if (!!(process.env.NODE_ENV !== \"production\") && !isElementRoot(root)) {\n warn$1(\n `Component inside renders non-element root node that cannot be animated.`\n );\n }\n root.transition = vnode.transition;\n }\n if (!!(process.env.NODE_ENV !== \"production\") && setRoot) {\n setRoot(root);\n } else {\n result = root;\n }\n setCurrentRenderingInstance(prev);\n return result;\n}\nconst getChildRoot = (vnode) => {\n const rawChildren = vnode.children;\n const dynamicChildren = vnode.dynamicChildren;\n const childRoot = filterSingleRoot(rawChildren, false);\n if (!childRoot) {\n return [vnode, void 0];\n } else if (!!(process.env.NODE_ENV !== \"production\") && childRoot.patchFlag > 0 && childRoot.patchFlag & 2048) {\n return getChildRoot(childRoot);\n }\n const index = rawChildren.indexOf(childRoot);\n const dynamicIndex = dynamicChildren ? dynamicChildren.indexOf(childRoot) : -1;\n const setRoot = (updatedRoot) => {\n rawChildren[index] = updatedRoot;\n if (dynamicChildren) {\n if (dynamicIndex > -1) {\n dynamicChildren[dynamicIndex] = updatedRoot;\n } else if (updatedRoot.patchFlag > 0) {\n vnode.dynamicChildren = [...dynamicChildren, updatedRoot];\n }\n }\n };\n return [normalizeVNode(childRoot), setRoot];\n};\nfunction filterSingleRoot(children, recurse = true) {\n let singleRoot;\n for (let i = 0; i < children.length; i++) {\n const child = children[i];\n if (isVNode(child)) {\n if (child.type !== Comment || child.children === \"v-if\") {\n if (singleRoot) {\n return;\n } else {\n singleRoot = child;\n if (!!(process.env.NODE_ENV !== \"production\") && recurse && singleRoot.patchFlag > 0 && singleRoot.patchFlag & 2048) {\n return filterSingleRoot(singleRoot.children);\n }\n }\n }\n } else {\n return;\n }\n }\n return singleRoot;\n}\nconst getFunctionalFallthrough = (attrs) => {\n let res;\n for (const key in attrs) {\n if (key === \"class\" || key === \"style\" || isOn(key)) {\n (res || (res = {}))[key] = attrs[key];\n }\n }\n return res;\n};\nconst filterModelListeners = (attrs, props) => {\n const res = {};\n for (const key in attrs) {\n if (!isModelListener(key) || !(key.slice(9) in props)) {\n res[key] = attrs[key];\n }\n }\n return res;\n};\nconst isElementRoot = (vnode) => {\n return vnode.shapeFlag & (6 | 1) || vnode.type === Comment;\n};\nfunction shouldUpdateComponent(prevVNode, nextVNode, optimized) {\n const { props: prevProps, children: prevChildren, component } = prevVNode;\n const { props: nextProps, children: nextChildren, patchFlag } = nextVNode;\n const emits = component.emitsOptions;\n if (!!(process.env.NODE_ENV !== \"production\") && (prevChildren || nextChildren) && isHmrUpdating) {\n return true;\n }\n if (nextVNode.dirs || nextVNode.transition) {\n return true;\n }\n if (optimized && patchFlag >= 0) {\n if (patchFlag & 1024) {\n return true;\n }\n if (patchFlag & 16) {\n if (!prevProps) {\n return !!nextProps;\n }\n return hasPropsChanged(prevProps, nextProps, emits);\n } else if (patchFlag & 8) {\n const dynamicProps = nextVNode.dynamicProps;\n for (let i = 0; i < dynamicProps.length; i++) {\n const key = dynamicProps[i];\n if (nextProps[key] !== prevProps[key] && !isEmitListener(emits, key)) {\n return true;\n }\n }\n }\n } else {\n if (prevChildren || nextChildren) {\n if (!nextChildren || !nextChildren.$stable) {\n return true;\n }\n }\n if (prevProps === nextProps) {\n return false;\n }\n if (!prevProps) {\n return !!nextProps;\n }\n if (!nextProps) {\n return true;\n }\n return hasPropsChanged(prevProps, nextProps, emits);\n }\n return false;\n}\nfunction hasPropsChanged(prevProps, nextProps, emitsOptions) {\n const nextKeys = Object.keys(nextProps);\n if (nextKeys.length !== Object.keys(prevProps).length) {\n return true;\n }\n for (let i = 0; i < nextKeys.length; i++) {\n const key = nextKeys[i];\n if (nextProps[key] !== prevProps[key] && !isEmitListener(emitsOptions, key)) {\n return true;\n }\n }\n return false;\n}\nfunction updateHOCHostEl({ vnode, parent }, el) {\n while (parent) {\n const root = parent.subTree;\n if (root.suspense && root.suspense.activeBranch === vnode) {\n root.el = vnode.el;\n }\n if (root === vnode) {\n (vnode = parent.vnode).el = el;\n parent = parent.parent;\n } else {\n break;\n }\n }\n}\n\nconst COMPONENTS = \"components\";\nconst DIRECTIVES = \"directives\";\nfunction resolveComponent(name, maybeSelfReference) {\n return resolveAsset(COMPONENTS, name, true, maybeSelfReference) || name;\n}\nconst NULL_DYNAMIC_COMPONENT = Symbol.for(\"v-ndc\");\nfunction resolveDynamicComponent(component) {\n if (isString(component)) {\n return resolveAsset(COMPONENTS, component, false) || component;\n } else {\n return component || NULL_DYNAMIC_COMPONENT;\n }\n}\nfunction resolveDirective(name) {\n return resolveAsset(DIRECTIVES, name);\n}\nfunction resolveAsset(type, name, warnMissing = true, maybeSelfReference = false) {\n const instance = currentRenderingInstance || currentInstance;\n if (instance) {\n const Component = instance.type;\n if (type === COMPONENTS) {\n const selfName = getComponentName(\n Component,\n false\n );\n if (selfName && (selfName === name || selfName === camelize(name) || selfName === capitalize(camelize(name)))) {\n return Component;\n }\n }\n const res = (\n // local registration\n // check instance[type] first which is resolved for options API\n resolve(instance[type] || Component[type], name) || // global registration\n resolve(instance.appContext[type], name)\n );\n if (!res && maybeSelfReference) {\n return Component;\n }\n if (!!(process.env.NODE_ENV !== \"production\") && warnMissing && !res) {\n const extra = type === COMPONENTS ? `\nIf this is a native custom element, make sure to exclude it from component resolution via compilerOptions.isCustomElement.` : ``;\n warn$1(`Failed to resolve ${type.slice(0, -1)}: ${name}${extra}`);\n }\n return res;\n } else if (!!(process.env.NODE_ENV !== \"production\")) {\n warn$1(\n `resolve${capitalize(type.slice(0, -1))} can only be used in render() or setup().`\n );\n }\n}\nfunction resolve(registry, name) {\n return registry && (registry[name] || registry[camelize(name)] || registry[capitalize(camelize(name))]);\n}\n\nconst isSuspense = (type) => type.__isSuspense;\nlet suspenseId = 0;\nconst SuspenseImpl = {\n name: \"Suspense\",\n // In order to make Suspense tree-shakable, we need to avoid importing it\n // directly in the renderer. The renderer checks for the __isSuspense flag\n // on a vnode's type and calls the `process` method, passing in renderer\n // internals.\n __isSuspense: true,\n process(n1, n2, container, anchor, parentComponent, parentSuspense, namespace, slotScopeIds, optimized, rendererInternals) {\n if (n1 == null) {\n mountSuspense(\n n2,\n container,\n anchor,\n parentComponent,\n parentSuspense,\n namespace,\n slotScopeIds,\n optimized,\n rendererInternals\n );\n } else {\n if (parentSuspense && parentSuspense.deps > 0 && !n1.suspense.isInFallback) {\n n2.suspense = n1.suspense;\n n2.suspense.vnode = n2;\n n2.el = n1.el;\n return;\n }\n patchSuspense(\n n1,\n n2,\n container,\n anchor,\n parentComponent,\n namespace,\n slotScopeIds,\n optimized,\n rendererInternals\n );\n }\n },\n hydrate: hydrateSuspense,\n create: createSuspenseBoundary,\n normalize: normalizeSuspenseChildren\n};\nconst Suspense = SuspenseImpl ;\nfunction triggerEvent(vnode, name) {\n const eventListener = vnode.props && vnode.props[name];\n if (isFunction(eventListener)) {\n eventListener();\n }\n}\nfunction mountSuspense(vnode, container, anchor, parentComponent, parentSuspense, namespace, slotScopeIds, optimized, rendererInternals) {\n const {\n p: patch,\n o: { createElement }\n } = rendererInternals;\n const hiddenContainer = createElement(\"div\");\n const suspense = vnode.suspense = createSuspenseBoundary(\n vnode,\n parentSuspense,\n parentComponent,\n container,\n hiddenContainer,\n anchor,\n namespace,\n slotScopeIds,\n optimized,\n rendererInternals\n );\n patch(\n null,\n suspense.pendingBranch = vnode.ssContent,\n hiddenContainer,\n null,\n parentComponent,\n suspense,\n namespace,\n slotScopeIds\n );\n if (suspense.deps > 0) {\n triggerEvent(vnode, \"onPending\");\n triggerEvent(vnode, \"onFallback\");\n patch(\n null,\n vnode.ssFallback,\n container,\n anchor,\n parentComponent,\n null,\n // fallback tree will not have suspense context\n namespace,\n slotScopeIds\n );\n setActiveBranch(suspense, vnode.ssFallback);\n } else {\n suspense.resolve(false, true);\n }\n}\nfunction patchSuspense(n1, n2, container, anchor, parentComponent, namespace, slotScopeIds, optimized, { p: patch, um: unmount, o: { createElement } }) {\n const suspense = n2.suspense = n1.suspense;\n suspense.vnode = n2;\n n2.el = n1.el;\n const newBranch = n2.ssContent;\n const newFallback = n2.ssFallback;\n const { activeBranch, pendingBranch, isInFallback, isHydrating } = suspense;\n if (pendingBranch) {\n suspense.pendingBranch = newBranch;\n if (isSameVNodeType(newBranch, pendingBranch)) {\n patch(\n pendingBranch,\n newBranch,\n suspense.hiddenContainer,\n null,\n parentComponent,\n suspense,\n namespace,\n slotScopeIds,\n optimized\n );\n if (suspense.deps <= 0) {\n suspense.resolve();\n } else if (isInFallback) {\n if (!isHydrating) {\n patch(\n activeBranch,\n newFallback,\n container,\n anchor,\n parentComponent,\n null,\n // fallback tree will not have suspense context\n namespace,\n slotScopeIds,\n optimized\n );\n setActiveBranch(suspense, newFallback);\n }\n }\n } else {\n suspense.pendingId = suspenseId++;\n if (isHydrating) {\n suspense.isHydrating = false;\n suspense.activeBranch = pendingBranch;\n } else {\n unmount(pendingBranch, parentComponent, suspense);\n }\n suspense.deps = 0;\n suspense.effects.length = 0;\n suspense.hiddenContainer = createElement(\"div\");\n if (isInFallback) {\n patch(\n null,\n newBranch,\n suspense.hiddenContainer,\n null,\n parentComponent,\n suspense,\n namespace,\n slotScopeIds,\n optimized\n );\n if (suspense.deps <= 0) {\n suspense.resolve();\n } else {\n patch(\n activeBranch,\n newFallback,\n container,\n anchor,\n parentComponent,\n null,\n // fallback tree will not have suspense context\n namespace,\n slotScopeIds,\n optimized\n );\n setActiveBranch(suspense, newFallback);\n }\n } else if (activeBranch && isSameVNodeType(newBranch, activeBranch)) {\n patch(\n activeBranch,\n newBranch,\n container,\n anchor,\n parentComponent,\n suspense,\n namespace,\n slotScopeIds,\n optimized\n );\n suspense.resolve(true);\n } else {\n patch(\n null,\n newBranch,\n suspense.hiddenContainer,\n null,\n parentComponent,\n suspense,\n namespace,\n slotScopeIds,\n optimized\n );\n if (suspense.deps <= 0) {\n suspense.resolve();\n }\n }\n }\n } else {\n if (activeBranch && isSameVNodeType(newBranch, activeBranch)) {\n patch(\n activeBranch,\n newBranch,\n container,\n anchor,\n parentComponent,\n suspense,\n namespace,\n slotScopeIds,\n optimized\n );\n setActiveBranch(suspense, newBranch);\n } else {\n triggerEvent(n2, \"onPending\");\n suspense.pendingBranch = newBranch;\n if (newBranch.shapeFlag & 512) {\n suspense.pendingId = newBranch.component.suspenseId;\n } else {\n suspense.pendingId = suspenseId++;\n }\n patch(\n null,\n newBranch,\n suspense.hiddenContainer,\n null,\n parentComponent,\n suspense,\n namespace,\n slotScopeIds,\n optimized\n );\n if (suspense.deps <= 0) {\n suspense.resolve();\n } else {\n const { timeout, pendingId } = suspense;\n if (timeout > 0) {\n setTimeout(() => {\n if (suspense.pendingId === pendingId) {\n suspense.fallback(newFallback);\n }\n }, timeout);\n } else if (timeout === 0) {\n suspense.fallback(newFallback);\n }\n }\n }\n }\n}\nlet hasWarned = false;\nfunction createSuspenseBoundary(vnode, parentSuspense, parentComponent, container, hiddenContainer, anchor, namespace, slotScopeIds, optimized, rendererInternals, isHydrating = false) {\n if (!!(process.env.NODE_ENV !== \"production\") && true && !hasWarned) {\n hasWarned = true;\n console[console.info ? \"info\" : \"log\"](\n ` is an experimental feature and its API will likely change.`\n );\n }\n const {\n p: patch,\n m: move,\n um: unmount,\n n: next,\n o: { parentNode, remove }\n } = rendererInternals;\n let parentSuspenseId;\n const isSuspensible = isVNodeSuspensible(vnode);\n if (isSuspensible) {\n if (parentSuspense == null ? void 0 : parentSuspense.pendingBranch) {\n parentSuspenseId = parentSuspense.pendingId;\n parentSuspense.deps++;\n }\n }\n const timeout = vnode.props ? toNumber(vnode.props.timeout) : void 0;\n if (!!(process.env.NODE_ENV !== \"production\")) {\n assertNumber(timeout, `Suspense timeout`);\n }\n const initialAnchor = anchor;\n const suspense = {\n vnode,\n parent: parentSuspense,\n parentComponent,\n namespace,\n container,\n hiddenContainer,\n deps: 0,\n pendingId: suspenseId++,\n timeout: typeof timeout === \"number\" ? timeout : -1,\n activeBranch: null,\n pendingBranch: null,\n isInFallback: !isHydrating,\n isHydrating,\n isUnmounted: false,\n effects: [],\n resolve(resume = false, sync = false) {\n if (!!(process.env.NODE_ENV !== \"production\")) {\n if (!resume && !suspense.pendingBranch) {\n throw new Error(\n `suspense.resolve() is called without a pending branch.`\n );\n }\n if (suspense.isUnmounted) {\n throw new Error(\n `suspense.resolve() is called on an already unmounted suspense boundary.`\n );\n }\n }\n const {\n vnode: vnode2,\n activeBranch,\n pendingBranch,\n pendingId,\n effects,\n parentComponent: parentComponent2,\n container: container2\n } = suspense;\n let delayEnter = false;\n if (suspense.isHydrating) {\n suspense.isHydrating = false;\n } else if (!resume) {\n delayEnter = activeBranch && pendingBranch.transition && pendingBranch.transition.mode === \"out-in\";\n if (delayEnter) {\n activeBranch.transition.afterLeave = () => {\n if (pendingId === suspense.pendingId) {\n move(\n pendingBranch,\n container2,\n anchor === initialAnchor ? next(activeBranch) : anchor,\n 0\n );\n queuePostFlushCb(effects);\n }\n };\n }\n if (activeBranch) {\n if (parentNode(activeBranch.el) !== suspense.hiddenContainer) {\n anchor = next(activeBranch);\n }\n unmount(activeBranch, parentComponent2, suspense, true);\n }\n if (!delayEnter) {\n move(pendingBranch, container2, anchor, 0);\n }\n }\n setActiveBranch(suspense, pendingBranch);\n suspense.pendingBranch = null;\n suspense.isInFallback = false;\n let parent = suspense.parent;\n let hasUnresolvedAncestor = false;\n while (parent) {\n if (parent.pendingBranch) {\n parent.effects.push(...effects);\n hasUnresolvedAncestor = true;\n break;\n }\n parent = parent.parent;\n }\n if (!hasUnresolvedAncestor && !delayEnter) {\n queuePostFlushCb(effects);\n }\n suspense.effects = [];\n if (isSuspensible) {\n if (parentSuspense && parentSuspense.pendingBranch && parentSuspenseId === parentSuspense.pendingId) {\n parentSuspense.deps--;\n if (parentSuspense.deps === 0 && !sync) {\n parentSuspense.resolve();\n }\n }\n }\n triggerEvent(vnode2, \"onResolve\");\n },\n fallback(fallbackVNode) {\n if (!suspense.pendingBranch) {\n return;\n }\n const { vnode: vnode2, activeBranch, parentComponent: parentComponent2, container: container2, namespace: namespace2 } = suspense;\n triggerEvent(vnode2, \"onFallback\");\n const anchor2 = next(activeBranch);\n const mountFallback = () => {\n if (!suspense.isInFallback) {\n return;\n }\n patch(\n null,\n fallbackVNode,\n container2,\n anchor2,\n parentComponent2,\n null,\n // fallback tree will not have suspense context\n namespace2,\n slotScopeIds,\n optimized\n );\n setActiveBranch(suspense, fallbackVNode);\n };\n const delayEnter = fallbackVNode.transition && fallbackVNode.transition.mode === \"out-in\";\n if (delayEnter) {\n activeBranch.transition.afterLeave = mountFallback;\n }\n suspense.isInFallback = true;\n unmount(\n activeBranch,\n parentComponent2,\n null,\n // no suspense so unmount hooks fire now\n true\n // shouldRemove\n );\n if (!delayEnter) {\n mountFallback();\n }\n },\n move(container2, anchor2, type) {\n suspense.activeBranch && move(suspense.activeBranch, container2, anchor2, type);\n suspense.container = container2;\n },\n next() {\n return suspense.activeBranch && next(suspense.activeBranch);\n },\n registerDep(instance, setupRenderEffect) {\n const isInPendingSuspense = !!suspense.pendingBranch;\n if (isInPendingSuspense) {\n suspense.deps++;\n }\n const hydratedEl = instance.vnode.el;\n instance.asyncDep.catch((err) => {\n handleError(err, instance, 0);\n }).then((asyncSetupResult) => {\n if (instance.isUnmounted || suspense.isUnmounted || suspense.pendingId !== instance.suspenseId) {\n return;\n }\n instance.asyncResolved = true;\n const { vnode: vnode2 } = instance;\n if (!!(process.env.NODE_ENV !== \"production\")) {\n pushWarningContext(vnode2);\n }\n handleSetupResult(instance, asyncSetupResult, false);\n if (hydratedEl) {\n vnode2.el = hydratedEl;\n }\n const placeholder = !hydratedEl && instance.subTree.el;\n setupRenderEffect(\n instance,\n vnode2,\n // component may have been moved before resolve.\n // if this is not a hydration, instance.subTree will be the comment\n // placeholder.\n parentNode(hydratedEl || instance.subTree.el),\n // anchor will not be used if this is hydration, so only need to\n // consider the comment placeholder case.\n hydratedEl ? null : next(instance.subTree),\n suspense,\n namespace,\n optimized\n );\n if (placeholder) {\n remove(placeholder);\n }\n updateHOCHostEl(instance, vnode2.el);\n if (!!(process.env.NODE_ENV !== \"production\")) {\n popWarningContext();\n }\n if (isInPendingSuspense && --suspense.deps === 0) {\n suspense.resolve();\n }\n });\n },\n unmount(parentSuspense2, doRemove) {\n suspense.isUnmounted = true;\n if (suspense.activeBranch) {\n unmount(\n suspense.activeBranch,\n parentComponent,\n parentSuspense2,\n doRemove\n );\n }\n if (suspense.pendingBranch) {\n unmount(\n suspense.pendingBranch,\n parentComponent,\n parentSuspense2,\n doRemove\n );\n }\n }\n };\n return suspense;\n}\nfunction hydrateSuspense(node, vnode, parentComponent, parentSuspense, namespace, slotScopeIds, optimized, rendererInternals, hydrateNode) {\n const suspense = vnode.suspense = createSuspenseBoundary(\n vnode,\n parentSuspense,\n parentComponent,\n node.parentNode,\n // eslint-disable-next-line no-restricted-globals\n document.createElement(\"div\"),\n null,\n namespace,\n slotScopeIds,\n optimized,\n rendererInternals,\n true\n );\n const result = hydrateNode(\n node,\n suspense.pendingBranch = vnode.ssContent,\n parentComponent,\n suspense,\n slotScopeIds,\n optimized\n );\n if (suspense.deps === 0) {\n suspense.resolve(false, true);\n }\n return result;\n}\nfunction normalizeSuspenseChildren(vnode) {\n const { shapeFlag, children } = vnode;\n const isSlotChildren = shapeFlag & 32;\n vnode.ssContent = normalizeSuspenseSlot(\n isSlotChildren ? children.default : children\n );\n vnode.ssFallback = isSlotChildren ? normalizeSuspenseSlot(children.fallback) : createVNode(Comment);\n}\nfunction normalizeSuspenseSlot(s) {\n let block;\n if (isFunction(s)) {\n const trackBlock = isBlockTreeEnabled && s._c;\n if (trackBlock) {\n s._d = false;\n openBlock();\n }\n s = s();\n if (trackBlock) {\n s._d = true;\n block = currentBlock;\n closeBlock();\n }\n }\n if (isArray(s)) {\n const singleChild = filterSingleRoot(s);\n if (!!(process.env.NODE_ENV !== \"production\") && !singleChild && s.filter((child) => child !== NULL_DYNAMIC_COMPONENT).length > 0) {\n warn$1(` slots expect a single root node.`);\n }\n s = singleChild;\n }\n s = normalizeVNode(s);\n if (block && !s.dynamicChildren) {\n s.dynamicChildren = block.filter((c) => c !== s);\n }\n return s;\n}\nfunction queueEffectWithSuspense(fn, suspense) {\n if (suspense && suspense.pendingBranch) {\n if (isArray(fn)) {\n suspense.effects.push(...fn);\n } else {\n suspense.effects.push(fn);\n }\n } else {\n queuePostFlushCb(fn);\n }\n}\nfunction setActiveBranch(suspense, branch) {\n suspense.activeBranch = branch;\n const { vnode, parentComponent } = suspense;\n let el = branch.el;\n while (!el && branch.component) {\n branch = branch.component.subTree;\n el = branch.el;\n }\n vnode.el = el;\n if (parentComponent && parentComponent.subTree === vnode) {\n parentComponent.vnode.el = el;\n updateHOCHostEl(parentComponent, el);\n }\n}\nfunction isVNodeSuspensible(vnode) {\n var _a;\n return ((_a = vnode.props) == null ? void 0 : _a.suspensible) != null && vnode.props.suspensible !== false;\n}\n\nconst ssrContextKey = Symbol.for(\"v-scx\");\nconst useSSRContext = () => {\n {\n const ctx = inject(ssrContextKey);\n if (!ctx) {\n !!(process.env.NODE_ENV !== \"production\") && warn$1(\n `Server rendering context not provided. Make sure to only call useSSRContext() conditionally in the server build.`\n );\n }\n return ctx;\n }\n};\n\nfunction watchEffect(effect, options) {\n return doWatch(effect, null, options);\n}\nfunction watchPostEffect(effect, options) {\n return doWatch(\n effect,\n null,\n !!(process.env.NODE_ENV !== \"production\") ? extend({}, options, { flush: \"post\" }) : { flush: \"post\" }\n );\n}\nfunction watchSyncEffect(effect, options) {\n return doWatch(\n effect,\n null,\n !!(process.env.NODE_ENV !== \"production\") ? extend({}, options, { flush: \"sync\" }) : { flush: \"sync\" }\n );\n}\nconst INITIAL_WATCHER_VALUE = {};\nfunction watch(source, cb, options) {\n if (!!(process.env.NODE_ENV !== \"production\") && !isFunction(cb)) {\n warn$1(\n `\\`watch(fn, options?)\\` signature has been moved to a separate API. Use \\`watchEffect(fn, options?)\\` instead. \\`watch\\` now only supports \\`watch(source, cb, options?) signature.`\n );\n }\n return doWatch(source, cb, options);\n}\nfunction doWatch(source, cb, {\n immediate,\n deep,\n flush,\n once,\n onTrack,\n onTrigger\n} = EMPTY_OBJ) {\n if (cb && once) {\n const _cb = cb;\n cb = (...args) => {\n _cb(...args);\n unwatch();\n };\n }\n if (!!(process.env.NODE_ENV !== \"production\") && deep !== void 0 && typeof deep === \"number\") {\n warn$1(\n `watch() \"deep\" option with number value will be used as watch depth in future versions. Please use a boolean instead to avoid potential breakage.`\n );\n }\n if (!!(process.env.NODE_ENV !== \"production\") && !cb) {\n if (immediate !== void 0) {\n warn$1(\n `watch() \"immediate\" option is only respected when using the watch(source, callback, options?) signature.`\n );\n }\n if (deep !== void 0) {\n warn$1(\n `watch() \"deep\" option is only respected when using the watch(source, callback, options?) signature.`\n );\n }\n if (once !== void 0) {\n warn$1(\n `watch() \"once\" option is only respected when using the watch(source, callback, options?) signature.`\n );\n }\n }\n const warnInvalidSource = (s) => {\n warn$1(\n `Invalid watch source: `,\n s,\n `A watch source can only be a getter/effect function, a ref, a reactive object, or an array of these types.`\n );\n };\n const instance = currentInstance;\n const reactiveGetter = (source2) => deep === true ? source2 : (\n // for deep: false, only traverse root-level properties\n traverse(source2, deep === false ? 1 : void 0)\n );\n let getter;\n let forceTrigger = false;\n let isMultiSource = false;\n if (isRef(source)) {\n getter = () => source.value;\n forceTrigger = isShallow(source);\n } else if (isReactive(source)) {\n getter = () => reactiveGetter(source);\n forceTrigger = true;\n } else if (isArray(source)) {\n isMultiSource = true;\n forceTrigger = source.some((s) => isReactive(s) || isShallow(s));\n getter = () => source.map((s) => {\n if (isRef(s)) {\n return s.value;\n } else if (isReactive(s)) {\n return reactiveGetter(s);\n } else if (isFunction(s)) {\n return callWithErrorHandling(s, instance, 2);\n } else {\n !!(process.env.NODE_ENV !== \"production\") && warnInvalidSource(s);\n }\n });\n } else if (isFunction(source)) {\n if (cb) {\n getter = () => callWithErrorHandling(source, instance, 2);\n } else {\n getter = () => {\n if (cleanup) {\n cleanup();\n }\n return callWithAsyncErrorHandling(\n source,\n instance,\n 3,\n [onCleanup]\n );\n };\n }\n } else {\n getter = NOOP;\n !!(process.env.NODE_ENV !== \"production\") && warnInvalidSource(source);\n }\n if (cb && deep) {\n const baseGetter = getter;\n getter = () => traverse(baseGetter());\n }\n let cleanup;\n let onCleanup = (fn) => {\n cleanup = effect.onStop = () => {\n callWithErrorHandling(fn, instance, 4);\n cleanup = effect.onStop = void 0;\n };\n };\n let ssrCleanup;\n if (isInSSRComponentSetup) {\n onCleanup = NOOP;\n if (!cb) {\n getter();\n } else if (immediate) {\n callWithAsyncErrorHandling(cb, instance, 3, [\n getter(),\n isMultiSource ? [] : void 0,\n onCleanup\n ]);\n }\n if (flush === \"sync\") {\n const ctx = useSSRContext();\n ssrCleanup = ctx.__watcherHandles || (ctx.__watcherHandles = []);\n } else {\n return NOOP;\n }\n }\n let oldValue = isMultiSource ? new Array(source.length).fill(INITIAL_WATCHER_VALUE) : INITIAL_WATCHER_VALUE;\n const job = () => {\n if (!effect.active || !effect.dirty) {\n return;\n }\n if (cb) {\n const newValue = effect.run();\n if (deep || forceTrigger || (isMultiSource ? newValue.some((v, i) => hasChanged(v, oldValue[i])) : hasChanged(newValue, oldValue)) || false) {\n if (cleanup) {\n cleanup();\n }\n callWithAsyncErrorHandling(cb, instance, 3, [\n newValue,\n // pass undefined as the old value when it's changed for the first time\n oldValue === INITIAL_WATCHER_VALUE ? void 0 : isMultiSource && oldValue[0] === INITIAL_WATCHER_VALUE ? [] : oldValue,\n onCleanup\n ]);\n oldValue = newValue;\n }\n } else {\n effect.run();\n }\n };\n job.allowRecurse = !!cb;\n let scheduler;\n if (flush === \"sync\") {\n scheduler = job;\n } else if (flush === \"post\") {\n scheduler = () => queuePostRenderEffect(job, instance && instance.suspense);\n } else {\n job.pre = true;\n if (instance)\n job.id = instance.uid;\n scheduler = () => queueJob(job);\n }\n const effect = new ReactiveEffect(getter, NOOP, scheduler);\n const scope = getCurrentScope();\n const unwatch = () => {\n effect.stop();\n if (scope) {\n remove(scope.effects, effect);\n }\n };\n if (!!(process.env.NODE_ENV !== \"production\")) {\n effect.onTrack = onTrack;\n effect.onTrigger = onTrigger;\n }\n if (cb) {\n if (immediate) {\n job();\n } else {\n oldValue = effect.run();\n }\n } else if (flush === \"post\") {\n queuePostRenderEffect(\n effect.run.bind(effect),\n instance && instance.suspense\n );\n } else {\n effect.run();\n }\n if (ssrCleanup)\n ssrCleanup.push(unwatch);\n return unwatch;\n}\nfunction instanceWatch(source, value, options) {\n const publicThis = this.proxy;\n const getter = isString(source) ? source.includes(\".\") ? createPathGetter(publicThis, source) : () => publicThis[source] : source.bind(publicThis, publicThis);\n let cb;\n if (isFunction(value)) {\n cb = value;\n } else {\n cb = value.handler;\n options = value;\n }\n const reset = setCurrentInstance(this);\n const res = doWatch(getter, cb.bind(publicThis), options);\n reset();\n return res;\n}\nfunction createPathGetter(ctx, path) {\n const segments = path.split(\".\");\n return () => {\n let cur = ctx;\n for (let i = 0; i < segments.length && cur; i++) {\n cur = cur[segments[i]];\n }\n return cur;\n };\n}\nfunction traverse(value, depth, currentDepth = 0, seen) {\n if (!isObject(value) || value[\"__v_skip\"]) {\n return value;\n }\n if (depth && depth > 0) {\n if (currentDepth >= depth) {\n return value;\n }\n currentDepth++;\n }\n seen = seen || /* @__PURE__ */ new Set();\n if (seen.has(value)) {\n return value;\n }\n seen.add(value);\n if (isRef(value)) {\n traverse(value.value, depth, currentDepth, seen);\n } else if (isArray(value)) {\n for (let i = 0; i < value.length; i++) {\n traverse(value[i], depth, currentDepth, seen);\n }\n } else if (isSet(value) || isMap(value)) {\n value.forEach((v) => {\n traverse(v, depth, currentDepth, seen);\n });\n } else if (isPlainObject(value)) {\n for (const key in value) {\n traverse(value[key], depth, currentDepth, seen);\n }\n }\n return value;\n}\n\nfunction validateDirectiveName(name) {\n if (isBuiltInDirective(name)) {\n warn$1(\"Do not use built-in directive ids as custom directive id: \" + name);\n }\n}\nfunction withDirectives(vnode, directives) {\n if (currentRenderingInstance === null) {\n !!(process.env.NODE_ENV !== \"production\") && warn$1(`withDirectives can only be used inside render functions.`);\n return vnode;\n }\n const instance = getExposeProxy(currentRenderingInstance) || currentRenderingInstance.proxy;\n const bindings = vnode.dirs || (vnode.dirs = []);\n for (let i = 0; i < directives.length; i++) {\n let [dir, value, arg, modifiers = EMPTY_OBJ] = directives[i];\n if (dir) {\n if (isFunction(dir)) {\n dir = {\n mounted: dir,\n updated: dir\n };\n }\n if (dir.deep) {\n traverse(value);\n }\n bindings.push({\n dir,\n instance,\n value,\n oldValue: void 0,\n arg,\n modifiers\n });\n }\n }\n return vnode;\n}\nfunction invokeDirectiveHook(vnode, prevVNode, instance, name) {\n const bindings = vnode.dirs;\n const oldBindings = prevVNode && prevVNode.dirs;\n for (let i = 0; i < bindings.length; i++) {\n const binding = bindings[i];\n if (oldBindings) {\n binding.oldValue = oldBindings[i].value;\n }\n let hook = binding.dir[name];\n if (hook) {\n pauseTracking();\n callWithAsyncErrorHandling(hook, instance, 8, [\n vnode.el,\n binding,\n vnode,\n prevVNode\n ]);\n resetTracking();\n }\n }\n}\n\nconst leaveCbKey = Symbol(\"_leaveCb\");\nconst enterCbKey = Symbol(\"_enterCb\");\nfunction useTransitionState() {\n const state = {\n isMounted: false,\n isLeaving: false,\n isUnmounting: false,\n leavingVNodes: /* @__PURE__ */ new Map()\n };\n onMounted(() => {\n state.isMounted = true;\n });\n onBeforeUnmount(() => {\n state.isUnmounting = true;\n });\n return state;\n}\nconst TransitionHookValidator = [Function, Array];\nconst BaseTransitionPropsValidators = {\n mode: String,\n appear: Boolean,\n persisted: Boolean,\n // enter\n onBeforeEnter: TransitionHookValidator,\n onEnter: TransitionHookValidator,\n onAfterEnter: TransitionHookValidator,\n onEnterCancelled: TransitionHookValidator,\n // leave\n onBeforeLeave: TransitionHookValidator,\n onLeave: TransitionHookValidator,\n onAfterLeave: TransitionHookValidator,\n onLeaveCancelled: TransitionHookValidator,\n // appear\n onBeforeAppear: TransitionHookValidator,\n onAppear: TransitionHookValidator,\n onAfterAppear: TransitionHookValidator,\n onAppearCancelled: TransitionHookValidator\n};\nconst BaseTransitionImpl = {\n name: `BaseTransition`,\n props: BaseTransitionPropsValidators,\n setup(props, { slots }) {\n const instance = getCurrentInstance();\n const state = useTransitionState();\n return () => {\n const children = slots.default && getTransitionRawChildren(slots.default(), true);\n if (!children || !children.length) {\n return;\n }\n let child = children[0];\n if (children.length > 1) {\n let hasFound = false;\n for (const c of children) {\n if (c.type !== Comment) {\n if (!!(process.env.NODE_ENV !== \"production\") && hasFound) {\n warn$1(\n \" can only be used on a single element or component. Use for lists.\"\n );\n break;\n }\n child = c;\n hasFound = true;\n if (!!!(process.env.NODE_ENV !== \"production\"))\n break;\n }\n }\n }\n const rawProps = toRaw(props);\n const { mode } = rawProps;\n if (!!(process.env.NODE_ENV !== \"production\") && mode && mode !== \"in-out\" && mode !== \"out-in\" && mode !== \"default\") {\n warn$1(`invalid mode: ${mode}`);\n }\n if (state.isLeaving) {\n return emptyPlaceholder(child);\n }\n const innerChild = getKeepAliveChild(child);\n if (!innerChild) {\n return emptyPlaceholder(child);\n }\n const enterHooks = resolveTransitionHooks(\n innerChild,\n rawProps,\n state,\n instance\n );\n setTransitionHooks(innerChild, enterHooks);\n const oldChild = instance.subTree;\n const oldInnerChild = oldChild && getKeepAliveChild(oldChild);\n if (oldInnerChild && oldInnerChild.type !== Comment && !isSameVNodeType(innerChild, oldInnerChild)) {\n const leavingHooks = resolveTransitionHooks(\n oldInnerChild,\n rawProps,\n state,\n instance\n );\n setTransitionHooks(oldInnerChild, leavingHooks);\n if (mode === \"out-in\") {\n state.isLeaving = true;\n leavingHooks.afterLeave = () => {\n state.isLeaving = false;\n if (instance.update.active !== false) {\n instance.effect.dirty = true;\n instance.update();\n }\n };\n return emptyPlaceholder(child);\n } else if (mode === \"in-out\" && innerChild.type !== Comment) {\n leavingHooks.delayLeave = (el, earlyRemove, delayedLeave) => {\n const leavingVNodesCache = getLeavingNodesForType(\n state,\n oldInnerChild\n );\n leavingVNodesCache[String(oldInnerChild.key)] = oldInnerChild;\n el[leaveCbKey] = () => {\n earlyRemove();\n el[leaveCbKey] = void 0;\n delete enterHooks.delayedLeave;\n };\n enterHooks.delayedLeave = delayedLeave;\n };\n }\n }\n return child;\n };\n }\n};\nconst BaseTransition = BaseTransitionImpl;\nfunction getLeavingNodesForType(state, vnode) {\n const { leavingVNodes } = state;\n let leavingVNodesCache = leavingVNodes.get(vnode.type);\n if (!leavingVNodesCache) {\n leavingVNodesCache = /* @__PURE__ */ Object.create(null);\n leavingVNodes.set(vnode.type, leavingVNodesCache);\n }\n return leavingVNodesCache;\n}\nfunction resolveTransitionHooks(vnode, props, state, instance) {\n const {\n appear,\n mode,\n persisted = false,\n onBeforeEnter,\n onEnter,\n onAfterEnter,\n onEnterCancelled,\n onBeforeLeave,\n onLeave,\n onAfterLeave,\n onLeaveCancelled,\n onBeforeAppear,\n onAppear,\n onAfterAppear,\n onAppearCancelled\n } = props;\n const key = String(vnode.key);\n const leavingVNodesCache = getLeavingNodesForType(state, vnode);\n const callHook = (hook, args) => {\n hook && callWithAsyncErrorHandling(\n hook,\n instance,\n 9,\n args\n );\n };\n const callAsyncHook = (hook, args) => {\n const done = args[1];\n callHook(hook, args);\n if (isArray(hook)) {\n if (hook.every((hook2) => hook2.length <= 1))\n done();\n } else if (hook.length <= 1) {\n done();\n }\n };\n const hooks = {\n mode,\n persisted,\n beforeEnter(el) {\n let hook = onBeforeEnter;\n if (!state.isMounted) {\n if (appear) {\n hook = onBeforeAppear || onBeforeEnter;\n } else {\n return;\n }\n }\n if (el[leaveCbKey]) {\n el[leaveCbKey](\n true\n /* cancelled */\n );\n }\n const leavingVNode = leavingVNodesCache[key];\n if (leavingVNode && isSameVNodeType(vnode, leavingVNode) && leavingVNode.el[leaveCbKey]) {\n leavingVNode.el[leaveCbKey]();\n }\n callHook(hook, [el]);\n },\n enter(el) {\n let hook = onEnter;\n let afterHook = onAfterEnter;\n let cancelHook = onEnterCancelled;\n if (!state.isMounted) {\n if (appear) {\n hook = onAppear || onEnter;\n afterHook = onAfterAppear || onAfterEnter;\n cancelHook = onAppearCancelled || onEnterCancelled;\n } else {\n return;\n }\n }\n let called = false;\n const done = el[enterCbKey] = (cancelled) => {\n if (called)\n return;\n called = true;\n if (cancelled) {\n callHook(cancelHook, [el]);\n } else {\n callHook(afterHook, [el]);\n }\n if (hooks.delayedLeave) {\n hooks.delayedLeave();\n }\n el[enterCbKey] = void 0;\n };\n if (hook) {\n callAsyncHook(hook, [el, done]);\n } else {\n done();\n }\n },\n leave(el, remove) {\n const key2 = String(vnode.key);\n if (el[enterCbKey]) {\n el[enterCbKey](\n true\n /* cancelled */\n );\n }\n if (state.isUnmounting) {\n return remove();\n }\n callHook(onBeforeLeave, [el]);\n let called = false;\n const done = el[leaveCbKey] = (cancelled) => {\n if (called)\n return;\n called = true;\n remove();\n if (cancelled) {\n callHook(onLeaveCancelled, [el]);\n } else {\n callHook(onAfterLeave, [el]);\n }\n el[leaveCbKey] = void 0;\n if (leavingVNodesCache[key2] === vnode) {\n delete leavingVNodesCache[key2];\n }\n };\n leavingVNodesCache[key2] = vnode;\n if (onLeave) {\n callAsyncHook(onLeave, [el, done]);\n } else {\n done();\n }\n },\n clone(vnode2) {\n return resolveTransitionHooks(vnode2, props, state, instance);\n }\n };\n return hooks;\n}\nfunction emptyPlaceholder(vnode) {\n if (isKeepAlive(vnode)) {\n vnode = cloneVNode(vnode);\n vnode.children = null;\n return vnode;\n }\n}\nfunction getKeepAliveChild(vnode) {\n return isKeepAlive(vnode) ? (\n // #7121 ensure get the child component subtree in case\n // it's been replaced during HMR\n !!(process.env.NODE_ENV !== \"production\") && vnode.component ? vnode.component.subTree : vnode.children ? vnode.children[0] : void 0\n ) : vnode;\n}\nfunction setTransitionHooks(vnode, hooks) {\n if (vnode.shapeFlag & 6 && vnode.component) {\n setTransitionHooks(vnode.component.subTree, hooks);\n } else if (vnode.shapeFlag & 128) {\n vnode.ssContent.transition = hooks.clone(vnode.ssContent);\n vnode.ssFallback.transition = hooks.clone(vnode.ssFallback);\n } else {\n vnode.transition = hooks;\n }\n}\nfunction getTransitionRawChildren(children, keepComment = false, parentKey) {\n let ret = [];\n let keyedFragmentCount = 0;\n for (let i = 0; i < children.length; i++) {\n let child = children[i];\n const key = parentKey == null ? child.key : String(parentKey) + String(child.key != null ? child.key : i);\n if (child.type === Fragment) {\n if (child.patchFlag & 128)\n keyedFragmentCount++;\n ret = ret.concat(\n getTransitionRawChildren(child.children, keepComment, key)\n );\n } else if (keepComment || child.type !== Comment) {\n ret.push(key != null ? cloneVNode(child, { key }) : child);\n }\n }\n if (keyedFragmentCount > 1) {\n for (let i = 0; i < ret.length; i++) {\n ret[i].patchFlag = -2;\n }\n }\n return ret;\n}\n\n/*! #__NO_SIDE_EFFECTS__ */\n// @__NO_SIDE_EFFECTS__\nfunction defineComponent(options, extraOptions) {\n return isFunction(options) ? (\n // #8326: extend call and options.name access are considered side-effects\n // by Rollup, so we have to wrap it in a pure-annotated IIFE.\n /* @__PURE__ */ (() => extend({ name: options.name }, extraOptions, { setup: options }))()\n ) : options;\n}\n\nconst isAsyncWrapper = (i) => !!i.type.__asyncLoader;\n/*! #__NO_SIDE_EFFECTS__ */\n// @__NO_SIDE_EFFECTS__\nfunction defineAsyncComponent(source) {\n if (isFunction(source)) {\n source = { loader: source };\n }\n const {\n loader,\n loadingComponent,\n errorComponent,\n delay = 200,\n timeout,\n // undefined = never times out\n suspensible = true,\n onError: userOnError\n } = source;\n let pendingRequest = null;\n let resolvedComp;\n let retries = 0;\n const retry = () => {\n retries++;\n pendingRequest = null;\n return load();\n };\n const load = () => {\n let thisRequest;\n return pendingRequest || (thisRequest = pendingRequest = loader().catch((err) => {\n err = err instanceof Error ? err : new Error(String(err));\n if (userOnError) {\n return new Promise((resolve, reject) => {\n const userRetry = () => resolve(retry());\n const userFail = () => reject(err);\n userOnError(err, userRetry, userFail, retries + 1);\n });\n } else {\n throw err;\n }\n }).then((comp) => {\n if (thisRequest !== pendingRequest && pendingRequest) {\n return pendingRequest;\n }\n if (!!(process.env.NODE_ENV !== \"production\") && !comp) {\n warn$1(\n `Async component loader resolved to undefined. If you are using retry(), make sure to return its return value.`\n );\n }\n if (comp && (comp.__esModule || comp[Symbol.toStringTag] === \"Module\")) {\n comp = comp.default;\n }\n if (!!(process.env.NODE_ENV !== \"production\") && comp && !isObject(comp) && !isFunction(comp)) {\n throw new Error(`Invalid async component load result: ${comp}`);\n }\n resolvedComp = comp;\n return comp;\n }));\n };\n return defineComponent({\n name: \"AsyncComponentWrapper\",\n __asyncLoader: load,\n get __asyncResolved() {\n return resolvedComp;\n },\n setup() {\n const instance = currentInstance;\n if (resolvedComp) {\n return () => createInnerComp(resolvedComp, instance);\n }\n const onError = (err) => {\n pendingRequest = null;\n handleError(\n err,\n instance,\n 13,\n !errorComponent\n );\n };\n if (suspensible && instance.suspense || isInSSRComponentSetup) {\n return load().then((comp) => {\n return () => createInnerComp(comp, instance);\n }).catch((err) => {\n onError(err);\n return () => errorComponent ? createVNode(errorComponent, {\n error: err\n }) : null;\n });\n }\n const loaded = ref(false);\n const error = ref();\n const delayed = ref(!!delay);\n if (delay) {\n setTimeout(() => {\n delayed.value = false;\n }, delay);\n }\n if (timeout != null) {\n setTimeout(() => {\n if (!loaded.value && !error.value) {\n const err = new Error(\n `Async component timed out after ${timeout}ms.`\n );\n onError(err);\n error.value = err;\n }\n }, timeout);\n }\n load().then(() => {\n loaded.value = true;\n if (instance.parent && isKeepAlive(instance.parent.vnode)) {\n instance.parent.effect.dirty = true;\n queueJob(instance.parent.update);\n }\n }).catch((err) => {\n onError(err);\n error.value = err;\n });\n return () => {\n if (loaded.value && resolvedComp) {\n return createInnerComp(resolvedComp, instance);\n } else if (error.value && errorComponent) {\n return createVNode(errorComponent, {\n error: error.value\n });\n } else if (loadingComponent && !delayed.value) {\n return createVNode(loadingComponent);\n }\n };\n }\n });\n}\nfunction createInnerComp(comp, parent) {\n const { ref: ref2, props, children, ce } = parent.vnode;\n const vnode = createVNode(comp, props, children);\n vnode.ref = ref2;\n vnode.ce = ce;\n delete parent.vnode.ce;\n return vnode;\n}\n\nconst isKeepAlive = (vnode) => vnode.type.__isKeepAlive;\nconst KeepAliveImpl = {\n name: `KeepAlive`,\n // Marker for special handling inside the renderer. We are not using a ===\n // check directly on KeepAlive in the renderer, because importing it directly\n // would prevent it from being tree-shaken.\n __isKeepAlive: true,\n props: {\n include: [String, RegExp, Array],\n exclude: [String, RegExp, Array],\n max: [String, Number]\n },\n setup(props, { slots }) {\n const instance = getCurrentInstance();\n const sharedContext = instance.ctx;\n if (!sharedContext.renderer) {\n return () => {\n const children = slots.default && slots.default();\n return children && children.length === 1 ? children[0] : children;\n };\n }\n const cache = /* @__PURE__ */ new Map();\n const keys = /* @__PURE__ */ new Set();\n let current = null;\n if (!!(process.env.NODE_ENV !== \"production\") || __VUE_PROD_DEVTOOLS__) {\n instance.__v_cache = cache;\n }\n const parentSuspense = instance.suspense;\n const {\n renderer: {\n p: patch,\n m: move,\n um: _unmount,\n o: { createElement }\n }\n } = sharedContext;\n const storageContainer = createElement(\"div\");\n sharedContext.activate = (vnode, container, anchor, namespace, optimized) => {\n const instance2 = vnode.component;\n move(vnode, container, anchor, 0, parentSuspense);\n patch(\n instance2.vnode,\n vnode,\n container,\n anchor,\n instance2,\n parentSuspense,\n namespace,\n vnode.slotScopeIds,\n optimized\n );\n queuePostRenderEffect(() => {\n instance2.isDeactivated = false;\n if (instance2.a) {\n invokeArrayFns(instance2.a);\n }\n const vnodeHook = vnode.props && vnode.props.onVnodeMounted;\n if (vnodeHook) {\n invokeVNodeHook(vnodeHook, instance2.parent, vnode);\n }\n }, parentSuspense);\n if (!!(process.env.NODE_ENV !== \"production\") || __VUE_PROD_DEVTOOLS__) {\n devtoolsComponentAdded(instance2);\n }\n };\n sharedContext.deactivate = (vnode) => {\n const instance2 = vnode.component;\n move(vnode, storageContainer, null, 1, parentSuspense);\n queuePostRenderEffect(() => {\n if (instance2.da) {\n invokeArrayFns(instance2.da);\n }\n const vnodeHook = vnode.props && vnode.props.onVnodeUnmounted;\n if (vnodeHook) {\n invokeVNodeHook(vnodeHook, instance2.parent, vnode);\n }\n instance2.isDeactivated = true;\n }, parentSuspense);\n if (!!(process.env.NODE_ENV !== \"production\") || __VUE_PROD_DEVTOOLS__) {\n devtoolsComponentAdded(instance2);\n }\n };\n function unmount(vnode) {\n resetShapeFlag(vnode);\n _unmount(vnode, instance, parentSuspense, true);\n }\n function pruneCache(filter) {\n cache.forEach((vnode, key) => {\n const name = getComponentName(vnode.type);\n if (name && (!filter || !filter(name))) {\n pruneCacheEntry(key);\n }\n });\n }\n function pruneCacheEntry(key) {\n const cached = cache.get(key);\n if (!current || !isSameVNodeType(cached, current)) {\n unmount(cached);\n } else if (current) {\n resetShapeFlag(current);\n }\n cache.delete(key);\n keys.delete(key);\n }\n watch(\n () => [props.include, props.exclude],\n ([include, exclude]) => {\n include && pruneCache((name) => matches(include, name));\n exclude && pruneCache((name) => !matches(exclude, name));\n },\n // prune post-render after `current` has been updated\n { flush: \"post\", deep: true }\n );\n let pendingCacheKey = null;\n const cacheSubtree = () => {\n if (pendingCacheKey != null) {\n cache.set(pendingCacheKey, getInnerChild(instance.subTree));\n }\n };\n onMounted(cacheSubtree);\n onUpdated(cacheSubtree);\n onBeforeUnmount(() => {\n cache.forEach((cached) => {\n const { subTree, suspense } = instance;\n const vnode = getInnerChild(subTree);\n if (cached.type === vnode.type && cached.key === vnode.key) {\n resetShapeFlag(vnode);\n const da = vnode.component.da;\n da && queuePostRenderEffect(da, suspense);\n return;\n }\n unmount(cached);\n });\n });\n return () => {\n pendingCacheKey = null;\n if (!slots.default) {\n return null;\n }\n const children = slots.default();\n const rawVNode = children[0];\n if (children.length > 1) {\n if (!!(process.env.NODE_ENV !== \"production\")) {\n warn$1(`KeepAlive should contain exactly one component child.`);\n }\n current = null;\n return children;\n } else if (!isVNode(rawVNode) || !(rawVNode.shapeFlag & 4) && !(rawVNode.shapeFlag & 128)) {\n current = null;\n return rawVNode;\n }\n let vnode = getInnerChild(rawVNode);\n const comp = vnode.type;\n const name = getComponentName(\n isAsyncWrapper(vnode) ? vnode.type.__asyncResolved || {} : comp\n );\n const { include, exclude, max } = props;\n if (include && (!name || !matches(include, name)) || exclude && name && matches(exclude, name)) {\n current = vnode;\n return rawVNode;\n }\n const key = vnode.key == null ? comp : vnode.key;\n const cachedVNode = cache.get(key);\n if (vnode.el) {\n vnode = cloneVNode(vnode);\n if (rawVNode.shapeFlag & 128) {\n rawVNode.ssContent = vnode;\n }\n }\n pendingCacheKey = key;\n if (cachedVNode) {\n vnode.el = cachedVNode.el;\n vnode.component = cachedVNode.component;\n if (vnode.transition) {\n setTransitionHooks(vnode, vnode.transition);\n }\n vnode.shapeFlag |= 512;\n keys.delete(key);\n keys.add(key);\n } else {\n keys.add(key);\n if (max && keys.size > parseInt(max, 10)) {\n pruneCacheEntry(keys.values().next().value);\n }\n }\n vnode.shapeFlag |= 256;\n current = vnode;\n return isSuspense(rawVNode.type) ? rawVNode : vnode;\n };\n }\n};\nconst KeepAlive = KeepAliveImpl;\nfunction matches(pattern, name) {\n if (isArray(pattern)) {\n return pattern.some((p) => matches(p, name));\n } else if (isString(pattern)) {\n return pattern.split(\",\").includes(name);\n } else if (isRegExp(pattern)) {\n return pattern.test(name);\n }\n return false;\n}\nfunction onActivated(hook, target) {\n registerKeepAliveHook(hook, \"a\", target);\n}\nfunction onDeactivated(hook, target) {\n registerKeepAliveHook(hook, \"da\", target);\n}\nfunction registerKeepAliveHook(hook, type, target = currentInstance) {\n const wrappedHook = hook.__wdc || (hook.__wdc = () => {\n let current = target;\n while (current) {\n if (current.isDeactivated) {\n return;\n }\n current = current.parent;\n }\n return hook();\n });\n injectHook(type, wrappedHook, target);\n if (target) {\n let current = target.parent;\n while (current && current.parent) {\n if (isKeepAlive(current.parent.vnode)) {\n injectToKeepAliveRoot(wrappedHook, type, target, current);\n }\n current = current.parent;\n }\n }\n}\nfunction injectToKeepAliveRoot(hook, type, target, keepAliveRoot) {\n const injected = injectHook(\n type,\n hook,\n keepAliveRoot,\n true\n /* prepend */\n );\n onUnmounted(() => {\n remove(keepAliveRoot[type], injected);\n }, target);\n}\nfunction resetShapeFlag(vnode) {\n vnode.shapeFlag &= ~256;\n vnode.shapeFlag &= ~512;\n}\nfunction getInnerChild(vnode) {\n return vnode.shapeFlag & 128 ? vnode.ssContent : vnode;\n}\n\nfunction injectHook(type, hook, target = currentInstance, prepend = false) {\n if (target) {\n const hooks = target[type] || (target[type] = []);\n const wrappedHook = hook.__weh || (hook.__weh = (...args) => {\n if (target.isUnmounted) {\n return;\n }\n pauseTracking();\n const reset = setCurrentInstance(target);\n const res = callWithAsyncErrorHandling(hook, target, type, args);\n reset();\n resetTracking();\n return res;\n });\n if (prepend) {\n hooks.unshift(wrappedHook);\n } else {\n hooks.push(wrappedHook);\n }\n return wrappedHook;\n } else if (!!(process.env.NODE_ENV !== \"production\")) {\n const apiName = toHandlerKey(ErrorTypeStrings$1[type].replace(/ hook$/, \"\"));\n warn$1(\n `${apiName} is called when there is no active component instance to be associated with. Lifecycle injection APIs can only be used during execution of setup().` + (` If you are using async setup(), make sure to register lifecycle hooks before the first await statement.` )\n );\n }\n}\nconst createHook = (lifecycle) => (hook, target = currentInstance) => (\n // post-create lifecycle registrations are noops during SSR (except for serverPrefetch)\n (!isInSSRComponentSetup || lifecycle === \"sp\") && injectHook(lifecycle, (...args) => hook(...args), target)\n);\nconst onBeforeMount = createHook(\"bm\");\nconst onMounted = createHook(\"m\");\nconst onBeforeUpdate = createHook(\"bu\");\nconst onUpdated = createHook(\"u\");\nconst onBeforeUnmount = createHook(\"bum\");\nconst onUnmounted = createHook(\"um\");\nconst onServerPrefetch = createHook(\"sp\");\nconst onRenderTriggered = createHook(\n \"rtg\"\n);\nconst onRenderTracked = createHook(\n \"rtc\"\n);\nfunction onErrorCaptured(hook, target = currentInstance) {\n injectHook(\"ec\", hook, target);\n}\n\nfunction renderList(source, renderItem, cache, index) {\n let ret;\n const cached = cache && cache[index];\n if (isArray(source) || isString(source)) {\n ret = new Array(source.length);\n for (let i = 0, l = source.length; i < l; i++) {\n ret[i] = renderItem(source[i], i, void 0, cached && cached[i]);\n }\n } else if (typeof source === \"number\") {\n if (!!(process.env.NODE_ENV !== \"production\") && !Number.isInteger(source)) {\n warn$1(`The v-for range expect an integer value but got ${source}.`);\n }\n ret = new Array(source);\n for (let i = 0; i < source; i++) {\n ret[i] = renderItem(i + 1, i, void 0, cached && cached[i]);\n }\n } else if (isObject(source)) {\n if (source[Symbol.iterator]) {\n ret = Array.from(\n source,\n (item, i) => renderItem(item, i, void 0, cached && cached[i])\n );\n } else {\n const keys = Object.keys(source);\n ret = new Array(keys.length);\n for (let i = 0, l = keys.length; i < l; i++) {\n const key = keys[i];\n ret[i] = renderItem(source[key], key, i, cached && cached[i]);\n }\n }\n } else {\n ret = [];\n }\n if (cache) {\n cache[index] = ret;\n }\n return ret;\n}\n\nfunction createSlots(slots, dynamicSlots) {\n for (let i = 0; i < dynamicSlots.length; i++) {\n const slot = dynamicSlots[i];\n if (isArray(slot)) {\n for (let j = 0; j < slot.length; j++) {\n slots[slot[j].name] = slot[j].fn;\n }\n } else if (slot) {\n slots[slot.name] = slot.key ? (...args) => {\n const res = slot.fn(...args);\n if (res)\n res.key = slot.key;\n return res;\n } : slot.fn;\n }\n }\n return slots;\n}\n\nfunction renderSlot(slots, name, props = {}, fallback, noSlotted) {\n if (currentRenderingInstance.isCE || currentRenderingInstance.parent && isAsyncWrapper(currentRenderingInstance.parent) && currentRenderingInstance.parent.isCE) {\n if (name !== \"default\")\n props.name = name;\n return createVNode(\"slot\", props, fallback && fallback());\n }\n let slot = slots[name];\n if (!!(process.env.NODE_ENV !== \"production\") && slot && slot.length > 1) {\n warn$1(\n `SSR-optimized slot function detected in a non-SSR-optimized render function. You need to mark this component with $dynamic-slots in the parent template.`\n );\n slot = () => [];\n }\n if (slot && slot._c) {\n slot._d = false;\n }\n openBlock();\n const validSlotContent = slot && ensureValidVNode(slot(props));\n const rendered = createBlock(\n Fragment,\n {\n key: props.key || // slot content array of a dynamic conditional slot may have a branch\n // key attached in the `createSlots` helper, respect that\n validSlotContent && validSlotContent.key || `_${name}`\n },\n validSlotContent || (fallback ? fallback() : []),\n validSlotContent && slots._ === 1 ? 64 : -2\n );\n if (!noSlotted && rendered.scopeId) {\n rendered.slotScopeIds = [rendered.scopeId + \"-s\"];\n }\n if (slot && slot._c) {\n slot._d = true;\n }\n return rendered;\n}\nfunction ensureValidVNode(vnodes) {\n return vnodes.some((child) => {\n if (!isVNode(child))\n return true;\n if (child.type === Comment)\n return false;\n if (child.type === Fragment && !ensureValidVNode(child.children))\n return false;\n return true;\n }) ? vnodes : null;\n}\n\nfunction toHandlers(obj, preserveCaseIfNecessary) {\n const ret = {};\n if (!!(process.env.NODE_ENV !== \"production\") && !isObject(obj)) {\n warn$1(`v-on with no argument expects an object value.`);\n return ret;\n }\n for (const key in obj) {\n ret[preserveCaseIfNecessary && /[A-Z]/.test(key) ? `on:${key}` : toHandlerKey(key)] = obj[key];\n }\n return ret;\n}\n\nconst getPublicInstance = (i) => {\n if (!i)\n return null;\n if (isStatefulComponent(i))\n return getExposeProxy(i) || i.proxy;\n return getPublicInstance(i.parent);\n};\nconst publicPropertiesMap = (\n // Move PURE marker to new line to workaround compiler discarding it\n // due to type annotation\n /* @__PURE__ */ extend(/* @__PURE__ */ Object.create(null), {\n $: (i) => i,\n $el: (i) => i.vnode.el,\n $data: (i) => i.data,\n $props: (i) => !!(process.env.NODE_ENV !== \"production\") ? shallowReadonly(i.props) : i.props,\n $attrs: (i) => !!(process.env.NODE_ENV !== \"production\") ? shallowReadonly(i.attrs) : i.attrs,\n $slots: (i) => !!(process.env.NODE_ENV !== \"production\") ? shallowReadonly(i.slots) : i.slots,\n $refs: (i) => !!(process.env.NODE_ENV !== \"production\") ? shallowReadonly(i.refs) : i.refs,\n $parent: (i) => getPublicInstance(i.parent),\n $root: (i) => getPublicInstance(i.root),\n $emit: (i) => i.emit,\n $options: (i) => __VUE_OPTIONS_API__ ? resolveMergedOptions(i) : i.type,\n $forceUpdate: (i) => i.f || (i.f = () => {\n i.effect.dirty = true;\n queueJob(i.update);\n }),\n $nextTick: (i) => i.n || (i.n = nextTick.bind(i.proxy)),\n $watch: (i) => __VUE_OPTIONS_API__ ? instanceWatch.bind(i) : NOOP\n })\n);\nconst isReservedPrefix = (key) => key === \"_\" || key === \"$\";\nconst hasSetupBinding = (state, key) => state !== EMPTY_OBJ && !state.__isScriptSetup && hasOwn(state, key);\nconst PublicInstanceProxyHandlers = {\n get({ _: instance }, key) {\n const { ctx, setupState, data, props, accessCache, type, appContext } = instance;\n if (!!(process.env.NODE_ENV !== \"production\") && key === \"__isVue\") {\n return true;\n }\n let normalizedProps;\n if (key[0] !== \"$\") {\n const n = accessCache[key];\n if (n !== void 0) {\n switch (n) {\n case 1 /* SETUP */:\n return setupState[key];\n case 2 /* DATA */:\n return data[key];\n case 4 /* CONTEXT */:\n return ctx[key];\n case 3 /* PROPS */:\n return props[key];\n }\n } else if (hasSetupBinding(setupState, key)) {\n accessCache[key] = 1 /* SETUP */;\n return setupState[key];\n } else if (data !== EMPTY_OBJ && hasOwn(data, key)) {\n accessCache[key] = 2 /* DATA */;\n return data[key];\n } else if (\n // only cache other properties when instance has declared (thus stable)\n // props\n (normalizedProps = instance.propsOptions[0]) && hasOwn(normalizedProps, key)\n ) {\n accessCache[key] = 3 /* PROPS */;\n return props[key];\n } else if (ctx !== EMPTY_OBJ && hasOwn(ctx, key)) {\n accessCache[key] = 4 /* CONTEXT */;\n return ctx[key];\n } else if (!__VUE_OPTIONS_API__ || shouldCacheAccess) {\n accessCache[key] = 0 /* OTHER */;\n }\n }\n const publicGetter = publicPropertiesMap[key];\n let cssModule, globalProperties;\n if (publicGetter) {\n if (key === \"$attrs\") {\n track(instance, \"get\", key);\n !!(process.env.NODE_ENV !== \"production\") && markAttrsAccessed();\n } else if (!!(process.env.NODE_ENV !== \"production\") && key === \"$slots\") {\n track(instance, \"get\", key);\n }\n return publicGetter(instance);\n } else if (\n // css module (injected by vue-loader)\n (cssModule = type.__cssModules) && (cssModule = cssModule[key])\n ) {\n return cssModule;\n } else if (ctx !== EMPTY_OBJ && hasOwn(ctx, key)) {\n accessCache[key] = 4 /* CONTEXT */;\n return ctx[key];\n } else if (\n // global properties\n globalProperties = appContext.config.globalProperties, hasOwn(globalProperties, key)\n ) {\n {\n return globalProperties[key];\n }\n } else if (!!(process.env.NODE_ENV !== \"production\") && currentRenderingInstance && (!isString(key) || // #1091 avoid internal isRef/isVNode checks on component instance leading\n // to infinite warning loop\n key.indexOf(\"__v\") !== 0)) {\n if (data !== EMPTY_OBJ && isReservedPrefix(key[0]) && hasOwn(data, key)) {\n warn$1(\n `Property ${JSON.stringify(\n key\n )} must be accessed via $data because it starts with a reserved character (\"$\" or \"_\") and is not proxied on the render context.`\n );\n } else if (instance === currentRenderingInstance) {\n warn$1(\n `Property ${JSON.stringify(key)} was accessed during render but is not defined on instance.`\n );\n }\n }\n },\n set({ _: instance }, key, value) {\n const { data, setupState, ctx } = instance;\n if (hasSetupBinding(setupState, key)) {\n setupState[key] = value;\n return true;\n } else if (!!(process.env.NODE_ENV !== \"production\") && setupState.__isScriptSetup && hasOwn(setupState, key)) {\n warn$1(`Cannot mutate \r\n\r\n\r\n","import Icon from './icon/icon.vue'\r\n\r\nexport default [\r\n Icon\r\n]\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","const isOutbound = (target) => {\r\n try {\r\n const currentDomain = window.location.hostname\r\n let linkHref = target.href\r\n\r\n if (!/^https?:\\/\\//.test(linkHref)) {\r\n linkHref = new URL(linkHref, window.location.href).href\r\n }\r\n\r\n const linkDomain = new URL(linkHref).hostname\r\n return linkDomain !== currentDomain\r\n } catch (error) {\r\n window.console.error('Error:', error)\r\n return false\r\n }\r\n}\r\n\r\nexport default isOutbound\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","function E () {\n // Keep this empty so it's easier to inherit from\n // (via https://github.com/lipsmack from https://github.com/scottcorgan/tiny-emitter/issues/3)\n}\n\nE.prototype = {\n on: function (name, callback, ctx) {\n var e = this.e || (this.e = {});\n\n (e[name] || (e[name] = [])).push({\n fn: callback,\n ctx: ctx\n });\n\n return this;\n },\n\n once: function (name, callback, ctx) {\n var self = this;\n function listener () {\n self.off(name, listener);\n callback.apply(ctx, arguments);\n };\n\n listener._ = callback\n return this.on(name, listener, ctx);\n },\n\n emit: function (name) {\n var data = [].slice.call(arguments, 1);\n var evtArr = ((this.e || (this.e = {}))[name] || []).slice();\n var i = 0;\n var len = evtArr.length;\n\n for (i; i < len; i++) {\n evtArr[i].fn.apply(evtArr[i].ctx, data);\n }\n\n return this;\n },\n\n off: function (name, callback) {\n var e = this.e || (this.e = {});\n var evts = e[name];\n var liveEvents = [];\n\n if (evts && callback) {\n for (var i = 0, len = evts.length; i < len; i++) {\n if (evts[i].fn !== callback && evts[i].fn._ !== callback)\n liveEvents.push(evts[i]);\n }\n }\n\n // Remove event from queue to prevent memory leak\n // Suggested by https://github.com/lazd\n // Ref: https://github.com/scottcorgan/tiny-emitter/commit/c6ebfaa9bc973b33d110a84a307742b7cf94c953#commitcomment-5024910\n\n (liveEvents.length)\n ? e[name] = liveEvents\n : delete e[name];\n\n return this;\n }\n};\n\nmodule.exports = E;\nmodule.exports.TinyEmitter = E;\n","var E = require('./index.js');\nmodule.exports = new E();\n","import emitter from 'tiny-emitter/instance'\r\n\r\nexport default {\r\n $on: (...args) => emitter.on(...args),\r\n $once: (...args) => emitter.once(...args),\r\n $off: (...args) => emitter.off(...args),\r\n $emit: (...args) => emitter.emit(...args)\r\n}\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","function _assertThisInitialized(self) { if (self === void 0) { throw new ReferenceError(\"this hasn't been initialised - super() hasn't been called\"); } return self; }\n\nfunction _inheritsLoose(subClass, superClass) { subClass.prototype = Object.create(superClass.prototype); subClass.prototype.constructor = subClass; subClass.__proto__ = superClass; }\n\n/*!\n * GSAP 3.12.5\n * https://gsap.com\n *\n * @license Copyright 2008-2024, GreenSock. All rights reserved.\n * Subject to the terms at https://gsap.com/standard-license or for\n * Club GSAP members, the agreement issued with that membership.\n * @author: Jack Doyle, jack@greensock.com\n*/\n\n/* eslint-disable */\nvar _config = {\n autoSleep: 120,\n force3D: \"auto\",\n nullTargetWarn: 1,\n units: {\n lineHeight: \"\"\n }\n},\n _defaults = {\n duration: .5,\n overwrite: false,\n delay: 0\n},\n _suppressOverwrites,\n _reverting,\n _context,\n _bigNum = 1e8,\n _tinyNum = 1 / _bigNum,\n _2PI = Math.PI * 2,\n _HALF_PI = _2PI / 4,\n _gsID = 0,\n _sqrt = Math.sqrt,\n _cos = Math.cos,\n _sin = Math.sin,\n _isString = function _isString(value) {\n return typeof value === \"string\";\n},\n _isFunction = function _isFunction(value) {\n return typeof value === \"function\";\n},\n _isNumber = function _isNumber(value) {\n return typeof value === \"number\";\n},\n _isUndefined = function _isUndefined(value) {\n return typeof value === \"undefined\";\n},\n _isObject = function _isObject(value) {\n return typeof value === \"object\";\n},\n _isNotFalse = function _isNotFalse(value) {\n return value !== false;\n},\n _windowExists = function _windowExists() {\n return typeof window !== \"undefined\";\n},\n _isFuncOrString = function _isFuncOrString(value) {\n return _isFunction(value) || _isString(value);\n},\n _isTypedArray = typeof ArrayBuffer === \"function\" && ArrayBuffer.isView || function () {},\n // note: IE10 has ArrayBuffer, but NOT ArrayBuffer.isView().\n_isArray = Array.isArray,\n _strictNumExp = /(?:-?\\.?\\d|\\.)+/gi,\n //only numbers (including negatives and decimals) but NOT relative values.\n_numExp = /[-+=.]*\\d+[.e\\-+]*\\d*[e\\-+]*\\d*/g,\n //finds any numbers, including ones that start with += or -=, negative numbers, and ones in scientific notation like 1e-8.\n_numWithUnitExp = /[-+=.]*\\d+[.e-]*\\d*[a-z%]*/g,\n _complexStringNumExp = /[-+=.]*\\d+\\.?\\d*(?:e-|e\\+)?\\d*/gi,\n //duplicate so that while we're looping through matches from exec(), it doesn't contaminate the lastIndex of _numExp which we use to search for colors too.\n_relExp = /[+-]=-?[.\\d]+/,\n _delimitedValueExp = /[^,'\"\\[\\]\\s]+/gi,\n // previously /[#\\-+.]*\\b[a-z\\d\\-=+%.]+/gi but didn't catch special characters.\n_unitExp = /^[+\\-=e\\s\\d]*\\d+[.\\d]*([a-z]*|%)\\s*$/i,\n _globalTimeline,\n _win,\n _coreInitted,\n _doc,\n _globals = {},\n _installScope = {},\n _coreReady,\n _install = function _install(scope) {\n return (_installScope = _merge(scope, _globals)) && gsap;\n},\n _missingPlugin = function _missingPlugin(property, value) {\n return console.warn(\"Invalid property\", property, \"set to\", value, \"Missing plugin? gsap.registerPlugin()\");\n},\n _warn = function _warn(message, suppress) {\n return !suppress && console.warn(message);\n},\n _addGlobal = function _addGlobal(name, obj) {\n return name && (_globals[name] = obj) && _installScope && (_installScope[name] = obj) || _globals;\n},\n _emptyFunc = function _emptyFunc() {\n return 0;\n},\n _startAtRevertConfig = {\n suppressEvents: true,\n isStart: true,\n kill: false\n},\n _revertConfigNoKill = {\n suppressEvents: true,\n kill: false\n},\n _revertConfig = {\n suppressEvents: true\n},\n _reservedProps = {},\n _lazyTweens = [],\n _lazyLookup = {},\n _lastRenderedFrame,\n _plugins = {},\n _effects = {},\n _nextGCFrame = 30,\n _harnessPlugins = [],\n _callbackNames = \"\",\n _harness = function _harness(targets) {\n var target = targets[0],\n harnessPlugin,\n i;\n _isObject(target) || _isFunction(target) || (targets = [targets]);\n\n if (!(harnessPlugin = (target._gsap || {}).harness)) {\n // find the first target with a harness. We assume targets passed into an animation will be of similar type, meaning the same kind of harness can be used for them all (performance optimization)\n i = _harnessPlugins.length;\n\n while (i-- && !_harnessPlugins[i].targetTest(target)) {}\n\n harnessPlugin = _harnessPlugins[i];\n }\n\n i = targets.length;\n\n while (i--) {\n targets[i] && (targets[i]._gsap || (targets[i]._gsap = new GSCache(targets[i], harnessPlugin))) || targets.splice(i, 1);\n }\n\n return targets;\n},\n _getCache = function _getCache(target) {\n return target._gsap || _harness(toArray(target))[0]._gsap;\n},\n _getProperty = function _getProperty(target, property, v) {\n return (v = target[property]) && _isFunction(v) ? target[property]() : _isUndefined(v) && target.getAttribute && target.getAttribute(property) || v;\n},\n _forEachName = function _forEachName(names, func) {\n return (names = names.split(\",\")).forEach(func) || names;\n},\n //split a comma-delimited list of names into an array, then run a forEach() function and return the split array (this is just a way to consolidate/shorten some code).\n_round = function _round(value) {\n return Math.round(value * 100000) / 100000 || 0;\n},\n _roundPrecise = function _roundPrecise(value) {\n return Math.round(value * 10000000) / 10000000 || 0;\n},\n // increased precision mostly for timing values.\n_parseRelative = function _parseRelative(start, value) {\n var operator = value.charAt(0),\n end = parseFloat(value.substr(2));\n start = parseFloat(start);\n return operator === \"+\" ? start + end : operator === \"-\" ? start - end : operator === \"*\" ? start * end : start / end;\n},\n _arrayContainsAny = function _arrayContainsAny(toSearch, toFind) {\n //searches one array to find matches for any of the items in the toFind array. As soon as one is found, it returns true. It does NOT return all the matches; it's simply a boolean search.\n var l = toFind.length,\n i = 0;\n\n for (; toSearch.indexOf(toFind[i]) < 0 && ++i < l;) {}\n\n return i < l;\n},\n _lazyRender = function _lazyRender() {\n var l = _lazyTweens.length,\n a = _lazyTweens.slice(0),\n i,\n tween;\n\n _lazyLookup = {};\n _lazyTweens.length = 0;\n\n for (i = 0; i < l; i++) {\n tween = a[i];\n tween && tween._lazy && (tween.render(tween._lazy[0], tween._lazy[1], true)._lazy = 0);\n }\n},\n _lazySafeRender = function _lazySafeRender(animation, time, suppressEvents, force) {\n _lazyTweens.length && !_reverting && _lazyRender();\n animation.render(time, suppressEvents, force || _reverting && time < 0 && (animation._initted || animation._startAt));\n _lazyTweens.length && !_reverting && _lazyRender(); //in case rendering caused any tweens to lazy-init, we should render them because typically when someone calls seek() or time() or progress(), they expect an immediate render.\n},\n _numericIfPossible = function _numericIfPossible(value) {\n var n = parseFloat(value);\n return (n || n === 0) && (value + \"\").match(_delimitedValueExp).length < 2 ? n : _isString(value) ? value.trim() : value;\n},\n _passThrough = function _passThrough(p) {\n return p;\n},\n _setDefaults = function _setDefaults(obj, defaults) {\n for (var p in defaults) {\n p in obj || (obj[p] = defaults[p]);\n }\n\n return obj;\n},\n _setKeyframeDefaults = function _setKeyframeDefaults(excludeDuration) {\n return function (obj, defaults) {\n for (var p in defaults) {\n p in obj || p === \"duration\" && excludeDuration || p === \"ease\" || (obj[p] = defaults[p]);\n }\n };\n},\n _merge = function _merge(base, toMerge) {\n for (var p in toMerge) {\n base[p] = toMerge[p];\n }\n\n return base;\n},\n _mergeDeep = function _mergeDeep(base, toMerge) {\n for (var p in toMerge) {\n p !== \"__proto__\" && p !== \"constructor\" && p !== \"prototype\" && (base[p] = _isObject(toMerge[p]) ? _mergeDeep(base[p] || (base[p] = {}), toMerge[p]) : toMerge[p]);\n }\n\n return base;\n},\n _copyExcluding = function _copyExcluding(obj, excluding) {\n var copy = {},\n p;\n\n for (p in obj) {\n p in excluding || (copy[p] = obj[p]);\n }\n\n return copy;\n},\n _inheritDefaults = function _inheritDefaults(vars) {\n var parent = vars.parent || _globalTimeline,\n func = vars.keyframes ? _setKeyframeDefaults(_isArray(vars.keyframes)) : _setDefaults;\n\n if (_isNotFalse(vars.inherit)) {\n while (parent) {\n func(vars, parent.vars.defaults);\n parent = parent.parent || parent._dp;\n }\n }\n\n return vars;\n},\n _arraysMatch = function _arraysMatch(a1, a2) {\n var i = a1.length,\n match = i === a2.length;\n\n while (match && i-- && a1[i] === a2[i]) {}\n\n return i < 0;\n},\n _addLinkedListItem = function _addLinkedListItem(parent, child, firstProp, lastProp, sortBy) {\n if (firstProp === void 0) {\n firstProp = \"_first\";\n }\n\n if (lastProp === void 0) {\n lastProp = \"_last\";\n }\n\n var prev = parent[lastProp],\n t;\n\n if (sortBy) {\n t = child[sortBy];\n\n while (prev && prev[sortBy] > t) {\n prev = prev._prev;\n }\n }\n\n if (prev) {\n child._next = prev._next;\n prev._next = child;\n } else {\n child._next = parent[firstProp];\n parent[firstProp] = child;\n }\n\n if (child._next) {\n child._next._prev = child;\n } else {\n parent[lastProp] = child;\n }\n\n child._prev = prev;\n child.parent = child._dp = parent;\n return child;\n},\n _removeLinkedListItem = function _removeLinkedListItem(parent, child, firstProp, lastProp) {\n if (firstProp === void 0) {\n firstProp = \"_first\";\n }\n\n if (lastProp === void 0) {\n lastProp = \"_last\";\n }\n\n var prev = child._prev,\n next = child._next;\n\n if (prev) {\n prev._next = next;\n } else if (parent[firstProp] === child) {\n parent[firstProp] = next;\n }\n\n if (next) {\n next._prev = prev;\n } else if (parent[lastProp] === child) {\n parent[lastProp] = prev;\n }\n\n child._next = child._prev = child.parent = null; // don't delete the _dp just so we can revert if necessary. But parent should be null to indicate the item isn't in a linked list.\n},\n _removeFromParent = function _removeFromParent(child, onlyIfParentHasAutoRemove) {\n child.parent && (!onlyIfParentHasAutoRemove || child.parent.autoRemoveChildren) && child.parent.remove && child.parent.remove(child);\n child._act = 0;\n},\n _uncache = function _uncache(animation, child) {\n if (animation && (!child || child._end > animation._dur || child._start < 0)) {\n // performance optimization: if a child animation is passed in we should only uncache if that child EXTENDS the animation (its end time is beyond the end)\n var a = animation;\n\n while (a) {\n a._dirty = 1;\n a = a.parent;\n }\n }\n\n return animation;\n},\n _recacheAncestors = function _recacheAncestors(animation) {\n var parent = animation.parent;\n\n while (parent && parent.parent) {\n //sometimes we must force a re-sort of all children and update the duration/totalDuration of all ancestor timelines immediately in case, for example, in the middle of a render loop, one tween alters another tween's timeScale which shoves its startTime before 0, forcing the parent timeline to shift around and shiftChildren() which could affect that next tween's render (startTime). Doesn't matter for the root timeline though.\n parent._dirty = 1;\n parent.totalDuration();\n parent = parent.parent;\n }\n\n return animation;\n},\n _rewindStartAt = function _rewindStartAt(tween, totalTime, suppressEvents, force) {\n return tween._startAt && (_reverting ? tween._startAt.revert(_revertConfigNoKill) : tween.vars.immediateRender && !tween.vars.autoRevert || tween._startAt.render(totalTime, true, force));\n},\n _hasNoPausedAncestors = function _hasNoPausedAncestors(animation) {\n return !animation || animation._ts && _hasNoPausedAncestors(animation.parent);\n},\n _elapsedCycleDuration = function _elapsedCycleDuration(animation) {\n return animation._repeat ? _animationCycle(animation._tTime, animation = animation.duration() + animation._rDelay) * animation : 0;\n},\n // feed in the totalTime and cycleDuration and it'll return the cycle (iteration minus 1) and if the playhead is exactly at the very END, it will NOT bump up to the next cycle.\n_animationCycle = function _animationCycle(tTime, cycleDuration) {\n var whole = Math.floor(tTime /= cycleDuration);\n return tTime && whole === tTime ? whole - 1 : whole;\n},\n _parentToChildTotalTime = function _parentToChildTotalTime(parentTime, child) {\n return (parentTime - child._start) * child._ts + (child._ts >= 0 ? 0 : child._dirty ? child.totalDuration() : child._tDur);\n},\n _setEnd = function _setEnd(animation) {\n return animation._end = _roundPrecise(animation._start + (animation._tDur / Math.abs(animation._ts || animation._rts || _tinyNum) || 0));\n},\n _alignPlayhead = function _alignPlayhead(animation, totalTime) {\n // adjusts the animation's _start and _end according to the provided totalTime (only if the parent's smoothChildTiming is true and the animation isn't paused). It doesn't do any rendering or forcing things back into parent timelines, etc. - that's what totalTime() is for.\n var parent = animation._dp;\n\n if (parent && parent.smoothChildTiming && animation._ts) {\n animation._start = _roundPrecise(parent._time - (animation._ts > 0 ? totalTime / animation._ts : ((animation._dirty ? animation.totalDuration() : animation._tDur) - totalTime) / -animation._ts));\n\n _setEnd(animation);\n\n parent._dirty || _uncache(parent, animation); //for performance improvement. If the parent's cache is already dirty, it already took care of marking the ancestors as dirty too, so skip the function call here.\n }\n\n return animation;\n},\n\n/*\n_totalTimeToTime = (clampedTotalTime, duration, repeat, repeatDelay, yoyo) => {\n\tlet cycleDuration = duration + repeatDelay,\n\t\ttime = _round(clampedTotalTime % cycleDuration);\n\tif (time > duration) {\n\t\ttime = duration;\n\t}\n\treturn (yoyo && (~~(clampedTotalTime / cycleDuration) & 1)) ? duration - time : time;\n},\n*/\n_postAddChecks = function _postAddChecks(timeline, child) {\n var t;\n\n if (child._time || !child._dur && child._initted || child._start < timeline._time && (child._dur || !child.add)) {\n // in case, for example, the _start is moved on a tween that has already rendered, or if it's being inserted into a timeline BEFORE where the playhead is currently. Imagine it's at its end state, then the startTime is moved WAY later (after the end of this timeline), it should render at its beginning. Special case: if it's a timeline (has .add() method) and no duration, we can skip rendering because the user may be populating it AFTER adding it to a parent timeline (unconventional, but possible, and we wouldn't want it to get removed if the parent's autoRemoveChildren is true).\n t = _parentToChildTotalTime(timeline.rawTime(), child);\n\n if (!child._dur || _clamp(0, child.totalDuration(), t) - child._tTime > _tinyNum) {\n child.render(t, true);\n }\n } //if the timeline has already ended but the inserted tween/timeline extends the duration, we should enable this timeline again so that it renders properly. We should also align the playhead with the parent timeline's when appropriate.\n\n\n if (_uncache(timeline, child)._dp && timeline._initted && timeline._time >= timeline._dur && timeline._ts) {\n //in case any of the ancestors had completed but should now be enabled...\n if (timeline._dur < timeline.duration()) {\n t = timeline;\n\n while (t._dp) {\n t.rawTime() >= 0 && t.totalTime(t._tTime); //moves the timeline (shifts its startTime) if necessary, and also enables it. If it's currently zero, though, it may not be scheduled to render until later so there's no need to force it to align with the current playhead position. Only move to catch up with the playhead.\n\n t = t._dp;\n }\n }\n\n timeline._zTime = -_tinyNum; // helps ensure that the next render() will be forced (crossingStart = true in render()), even if the duration hasn't changed (we're adding a child which would need to get rendered). Definitely an edge case. Note: we MUST do this AFTER the loop above where the totalTime() might trigger a render() because this _addToTimeline() method gets called from the Animation constructor, BEFORE tweens even record their targets, etc. so we wouldn't want things to get triggered in the wrong order.\n }\n},\n _addToTimeline = function _addToTimeline(timeline, child, position, skipChecks) {\n child.parent && _removeFromParent(child);\n child._start = _roundPrecise((_isNumber(position) ? position : position || timeline !== _globalTimeline ? _parsePosition(timeline, position, child) : timeline._time) + child._delay);\n child._end = _roundPrecise(child._start + (child.totalDuration() / Math.abs(child.timeScale()) || 0));\n\n _addLinkedListItem(timeline, child, \"_first\", \"_last\", timeline._sort ? \"_start\" : 0);\n\n _isFromOrFromStart(child) || (timeline._recent = child);\n skipChecks || _postAddChecks(timeline, child);\n timeline._ts < 0 && _alignPlayhead(timeline, timeline._tTime); // if the timeline is reversed and the new child makes it longer, we may need to adjust the parent's _start (push it back)\n\n return timeline;\n},\n _scrollTrigger = function _scrollTrigger(animation, trigger) {\n return (_globals.ScrollTrigger || _missingPlugin(\"scrollTrigger\", trigger)) && _globals.ScrollTrigger.create(trigger, animation);\n},\n _attemptInitTween = function _attemptInitTween(tween, time, force, suppressEvents, tTime) {\n _initTween(tween, time, tTime);\n\n if (!tween._initted) {\n return 1;\n }\n\n if (!force && tween._pt && !_reverting && (tween._dur && tween.vars.lazy !== false || !tween._dur && tween.vars.lazy) && _lastRenderedFrame !== _ticker.frame) {\n _lazyTweens.push(tween);\n\n tween._lazy = [tTime, suppressEvents];\n return 1;\n }\n},\n _parentPlayheadIsBeforeStart = function _parentPlayheadIsBeforeStart(_ref) {\n var parent = _ref.parent;\n return parent && parent._ts && parent._initted && !parent._lock && (parent.rawTime() < 0 || _parentPlayheadIsBeforeStart(parent));\n},\n // check parent's _lock because when a timeline repeats/yoyos and does its artificial wrapping, we shouldn't force the ratio back to 0\n_isFromOrFromStart = function _isFromOrFromStart(_ref2) {\n var data = _ref2.data;\n return data === \"isFromStart\" || data === \"isStart\";\n},\n _renderZeroDurationTween = function _renderZeroDurationTween(tween, totalTime, suppressEvents, force) {\n var prevRatio = tween.ratio,\n ratio = totalTime < 0 || !totalTime && (!tween._start && _parentPlayheadIsBeforeStart(tween) && !(!tween._initted && _isFromOrFromStart(tween)) || (tween._ts < 0 || tween._dp._ts < 0) && !_isFromOrFromStart(tween)) ? 0 : 1,\n // if the tween or its parent is reversed and the totalTime is 0, we should go to a ratio of 0. Edge case: if a from() or fromTo() stagger tween is placed later in a timeline, the \"startAt\" zero-duration tween could initially render at a time when the parent timeline's playhead is technically BEFORE where this tween is, so make sure that any \"from\" and \"fromTo\" startAt tweens are rendered the first time at a ratio of 1.\n repeatDelay = tween._rDelay,\n tTime = 0,\n pt,\n iteration,\n prevIteration;\n\n if (repeatDelay && tween._repeat) {\n // in case there's a zero-duration tween that has a repeat with a repeatDelay\n tTime = _clamp(0, tween._tDur, totalTime);\n iteration = _animationCycle(tTime, repeatDelay);\n tween._yoyo && iteration & 1 && (ratio = 1 - ratio);\n\n if (iteration !== _animationCycle(tween._tTime, repeatDelay)) {\n // if iteration changed\n prevRatio = 1 - ratio;\n tween.vars.repeatRefresh && tween._initted && tween.invalidate();\n }\n }\n\n if (ratio !== prevRatio || _reverting || force || tween._zTime === _tinyNum || !totalTime && tween._zTime) {\n if (!tween._initted && _attemptInitTween(tween, totalTime, force, suppressEvents, tTime)) {\n // if we render the very beginning (time == 0) of a fromTo(), we must force the render (normal tweens wouldn't need to render at a time of 0 when the prevTime was also 0). This is also mandatory to make sure overwriting kicks in immediately.\n return;\n }\n\n prevIteration = tween._zTime;\n tween._zTime = totalTime || (suppressEvents ? _tinyNum : 0); // when the playhead arrives at EXACTLY time 0 (right on top) of a zero-duration tween, we need to discern if events are suppressed so that when the playhead moves again (next time), it'll trigger the callback. If events are NOT suppressed, obviously the callback would be triggered in this render. Basically, the callback should fire either when the playhead ARRIVES or LEAVES this exact spot, not both. Imagine doing a timeline.seek(0) and there's a callback that sits at 0. Since events are suppressed on that seek() by default, nothing will fire, but when the playhead moves off of that position, the callback should fire. This behavior is what people intuitively expect.\n\n suppressEvents || (suppressEvents = totalTime && !prevIteration); // if it was rendered previously at exactly 0 (_zTime) and now the playhead is moving away, DON'T fire callbacks otherwise they'll seem like duplicates.\n\n tween.ratio = ratio;\n tween._from && (ratio = 1 - ratio);\n tween._time = 0;\n tween._tTime = tTime;\n pt = tween._pt;\n\n while (pt) {\n pt.r(ratio, pt.d);\n pt = pt._next;\n }\n\n totalTime < 0 && _rewindStartAt(tween, totalTime, suppressEvents, true);\n tween._onUpdate && !suppressEvents && _callback(tween, \"onUpdate\");\n tTime && tween._repeat && !suppressEvents && tween.parent && _callback(tween, \"onRepeat\");\n\n if ((totalTime >= tween._tDur || totalTime < 0) && tween.ratio === ratio) {\n ratio && _removeFromParent(tween, 1);\n\n if (!suppressEvents && !_reverting) {\n _callback(tween, ratio ? \"onComplete\" : \"onReverseComplete\", true);\n\n tween._prom && tween._prom();\n }\n }\n } else if (!tween._zTime) {\n tween._zTime = totalTime;\n }\n},\n _findNextPauseTween = function _findNextPauseTween(animation, prevTime, time) {\n var child;\n\n if (time > prevTime) {\n child = animation._first;\n\n while (child && child._start <= time) {\n if (child.data === \"isPause\" && child._start > prevTime) {\n return child;\n }\n\n child = child._next;\n }\n } else {\n child = animation._last;\n\n while (child && child._start >= time) {\n if (child.data === \"isPause\" && child._start < prevTime) {\n return child;\n }\n\n child = child._prev;\n }\n }\n},\n _setDuration = function _setDuration(animation, duration, skipUncache, leavePlayhead) {\n var repeat = animation._repeat,\n dur = _roundPrecise(duration) || 0,\n totalProgress = animation._tTime / animation._tDur;\n totalProgress && !leavePlayhead && (animation._time *= dur / animation._dur);\n animation._dur = dur;\n animation._tDur = !repeat ? dur : repeat < 0 ? 1e10 : _roundPrecise(dur * (repeat + 1) + animation._rDelay * repeat);\n totalProgress > 0 && !leavePlayhead && _alignPlayhead(animation, animation._tTime = animation._tDur * totalProgress);\n animation.parent && _setEnd(animation);\n skipUncache || _uncache(animation.parent, animation);\n return animation;\n},\n _onUpdateTotalDuration = function _onUpdateTotalDuration(animation) {\n return animation instanceof Timeline ? _uncache(animation) : _setDuration(animation, animation._dur);\n},\n _zeroPosition = {\n _start: 0,\n endTime: _emptyFunc,\n totalDuration: _emptyFunc\n},\n _parsePosition = function _parsePosition(animation, position, percentAnimation) {\n var labels = animation.labels,\n recent = animation._recent || _zeroPosition,\n clippedDuration = animation.duration() >= _bigNum ? recent.endTime(false) : animation._dur,\n //in case there's a child that infinitely repeats, users almost never intend for the insertion point of a new child to be based on a SUPER long value like that so we clip it and assume the most recently-added child's endTime should be used instead.\n i,\n offset,\n isPercent;\n\n if (_isString(position) && (isNaN(position) || position in labels)) {\n //if the string is a number like \"1\", check to see if there's a label with that name, otherwise interpret it as a number (absolute value).\n offset = position.charAt(0);\n isPercent = position.substr(-1) === \"%\";\n i = position.indexOf(\"=\");\n\n if (offset === \"<\" || offset === \">\") {\n i >= 0 && (position = position.replace(/=/, \"\"));\n return (offset === \"<\" ? recent._start : recent.endTime(recent._repeat >= 0)) + (parseFloat(position.substr(1)) || 0) * (isPercent ? (i < 0 ? recent : percentAnimation).totalDuration() / 100 : 1);\n }\n\n if (i < 0) {\n position in labels || (labels[position] = clippedDuration);\n return labels[position];\n }\n\n offset = parseFloat(position.charAt(i - 1) + position.substr(i + 1));\n\n if (isPercent && percentAnimation) {\n offset = offset / 100 * (_isArray(percentAnimation) ? percentAnimation[0] : percentAnimation).totalDuration();\n }\n\n return i > 1 ? _parsePosition(animation, position.substr(0, i - 1), percentAnimation) + offset : clippedDuration + offset;\n }\n\n return position == null ? clippedDuration : +position;\n},\n _createTweenType = function _createTweenType(type, params, timeline) {\n var isLegacy = _isNumber(params[1]),\n varsIndex = (isLegacy ? 2 : 1) + (type < 2 ? 0 : 1),\n vars = params[varsIndex],\n irVars,\n parent;\n\n isLegacy && (vars.duration = params[1]);\n vars.parent = timeline;\n\n if (type) {\n irVars = vars;\n parent = timeline;\n\n while (parent && !(\"immediateRender\" in irVars)) {\n // inheritance hasn't happened yet, but someone may have set a default in an ancestor timeline. We could do vars.immediateRender = _isNotFalse(_inheritDefaults(vars).immediateRender) but that'd exact a slight performance penalty because _inheritDefaults() also runs in the Tween constructor. We're paying a small kb price here to gain speed.\n irVars = parent.vars.defaults || {};\n parent = _isNotFalse(parent.vars.inherit) && parent.parent;\n }\n\n vars.immediateRender = _isNotFalse(irVars.immediateRender);\n type < 2 ? vars.runBackwards = 1 : vars.startAt = params[varsIndex - 1]; // \"from\" vars\n }\n\n return new Tween(params[0], vars, params[varsIndex + 1]);\n},\n _conditionalReturn = function _conditionalReturn(value, func) {\n return value || value === 0 ? func(value) : func;\n},\n _clamp = function _clamp(min, max, value) {\n return value < min ? min : value > max ? max : value;\n},\n getUnit = function getUnit(value, v) {\n return !_isString(value) || !(v = _unitExp.exec(value)) ? \"\" : v[1];\n},\n // note: protect against padded numbers as strings, like \"100.100\". That shouldn't return \"00\" as the unit. If it's numeric, return no unit.\nclamp = function clamp(min, max, value) {\n return _conditionalReturn(value, function (v) {\n return _clamp(min, max, v);\n });\n},\n _slice = [].slice,\n _isArrayLike = function _isArrayLike(value, nonEmpty) {\n return value && _isObject(value) && \"length\" in value && (!nonEmpty && !value.length || value.length - 1 in value && _isObject(value[0])) && !value.nodeType && value !== _win;\n},\n _flatten = function _flatten(ar, leaveStrings, accumulator) {\n if (accumulator === void 0) {\n accumulator = [];\n }\n\n return ar.forEach(function (value) {\n var _accumulator;\n\n return _isString(value) && !leaveStrings || _isArrayLike(value, 1) ? (_accumulator = accumulator).push.apply(_accumulator, toArray(value)) : accumulator.push(value);\n }) || accumulator;\n},\n //takes any value and returns an array. If it's a string (and leaveStrings isn't true), it'll use document.querySelectorAll() and convert that to an array. It'll also accept iterables like jQuery objects.\ntoArray = function toArray(value, scope, leaveStrings) {\n return _context && !scope && _context.selector ? _context.selector(value) : _isString(value) && !leaveStrings && (_coreInitted || !_wake()) ? _slice.call((scope || _doc).querySelectorAll(value), 0) : _isArray(value) ? _flatten(value, leaveStrings) : _isArrayLike(value) ? _slice.call(value, 0) : value ? [value] : [];\n},\n selector = function selector(value) {\n value = toArray(value)[0] || _warn(\"Invalid scope\") || {};\n return function (v) {\n var el = value.current || value.nativeElement || value;\n return toArray(v, el.querySelectorAll ? el : el === value ? _warn(\"Invalid scope\") || _doc.createElement(\"div\") : value);\n };\n},\n shuffle = function shuffle(a) {\n return a.sort(function () {\n return .5 - Math.random();\n });\n},\n // alternative that's a bit faster and more reliably diverse but bigger: for (let j, v, i = a.length; i; j = Math.floor(Math.random() * i), v = a[--i], a[i] = a[j], a[j] = v); return a;\n//for distributing values across an array. Can accept a number, a function or (most commonly) a function which can contain the following properties: {base, amount, from, ease, grid, axis, length, each}. Returns a function that expects the following parameters: index, target, array. Recognizes the following\ndistribute = function distribute(v) {\n if (_isFunction(v)) {\n return v;\n }\n\n var vars = _isObject(v) ? v : {\n each: v\n },\n //n:1 is just to indicate v was a number; we leverage that later to set v according to the length we get. If a number is passed in, we treat it like the old stagger value where 0.1, for example, would mean that things would be distributed with 0.1 between each element in the array rather than a total \"amount\" that's chunked out among them all.\n ease = _parseEase(vars.ease),\n from = vars.from || 0,\n base = parseFloat(vars.base) || 0,\n cache = {},\n isDecimal = from > 0 && from < 1,\n ratios = isNaN(from) || isDecimal,\n axis = vars.axis,\n ratioX = from,\n ratioY = from;\n\n if (_isString(from)) {\n ratioX = ratioY = {\n center: .5,\n edges: .5,\n end: 1\n }[from] || 0;\n } else if (!isDecimal && ratios) {\n ratioX = from[0];\n ratioY = from[1];\n }\n\n return function (i, target, a) {\n var l = (a || vars).length,\n distances = cache[l],\n originX,\n originY,\n x,\n y,\n d,\n j,\n max,\n min,\n wrapAt;\n\n if (!distances) {\n wrapAt = vars.grid === \"auto\" ? 0 : (vars.grid || [1, _bigNum])[1];\n\n if (!wrapAt) {\n max = -_bigNum;\n\n while (max < (max = a[wrapAt++].getBoundingClientRect().left) && wrapAt < l) {}\n\n wrapAt < l && wrapAt--;\n }\n\n distances = cache[l] = [];\n originX = ratios ? Math.min(wrapAt, l) * ratioX - .5 : from % wrapAt;\n originY = wrapAt === _bigNum ? 0 : ratios ? l * ratioY / wrapAt - .5 : from / wrapAt | 0;\n max = 0;\n min = _bigNum;\n\n for (j = 0; j < l; j++) {\n x = j % wrapAt - originX;\n y = originY - (j / wrapAt | 0);\n distances[j] = d = !axis ? _sqrt(x * x + y * y) : Math.abs(axis === \"y\" ? y : x);\n d > max && (max = d);\n d < min && (min = d);\n }\n\n from === \"random\" && shuffle(distances);\n distances.max = max - min;\n distances.min = min;\n distances.v = l = (parseFloat(vars.amount) || parseFloat(vars.each) * (wrapAt > l ? l - 1 : !axis ? Math.max(wrapAt, l / wrapAt) : axis === \"y\" ? l / wrapAt : wrapAt) || 0) * (from === \"edges\" ? -1 : 1);\n distances.b = l < 0 ? base - l : base;\n distances.u = getUnit(vars.amount || vars.each) || 0; //unit\n\n ease = ease && l < 0 ? _invertEase(ease) : ease;\n }\n\n l = (distances[i] - distances.min) / distances.max || 0;\n return _roundPrecise(distances.b + (ease ? ease(l) : l) * distances.v) + distances.u; //round in order to work around floating point errors\n };\n},\n _roundModifier = function _roundModifier(v) {\n //pass in 0.1 get a function that'll round to the nearest tenth, or 5 to round to the closest 5, or 0.001 to the closest 1000th, etc.\n var p = Math.pow(10, ((v + \"\").split(\".\")[1] || \"\").length); //to avoid floating point math errors (like 24 * 0.1 == 2.4000000000000004), we chop off at a specific number of decimal places (much faster than toFixed())\n\n return function (raw) {\n var n = _roundPrecise(Math.round(parseFloat(raw) / v) * v * p);\n\n return (n - n % 1) / p + (_isNumber(raw) ? 0 : getUnit(raw)); // n - n % 1 replaces Math.floor() in order to handle negative values properly. For example, Math.floor(-150.00000000000003) is 151!\n };\n},\n snap = function snap(snapTo, value) {\n var isArray = _isArray(snapTo),\n radius,\n is2D;\n\n if (!isArray && _isObject(snapTo)) {\n radius = isArray = snapTo.radius || _bigNum;\n\n if (snapTo.values) {\n snapTo = toArray(snapTo.values);\n\n if (is2D = !_isNumber(snapTo[0])) {\n radius *= radius; //performance optimization so we don't have to Math.sqrt() in the loop.\n }\n } else {\n snapTo = _roundModifier(snapTo.increment);\n }\n }\n\n return _conditionalReturn(value, !isArray ? _roundModifier(snapTo) : _isFunction(snapTo) ? function (raw) {\n is2D = snapTo(raw);\n return Math.abs(is2D - raw) <= radius ? is2D : raw;\n } : function (raw) {\n var x = parseFloat(is2D ? raw.x : raw),\n y = parseFloat(is2D ? raw.y : 0),\n min = _bigNum,\n closest = 0,\n i = snapTo.length,\n dx,\n dy;\n\n while (i--) {\n if (is2D) {\n dx = snapTo[i].x - x;\n dy = snapTo[i].y - y;\n dx = dx * dx + dy * dy;\n } else {\n dx = Math.abs(snapTo[i] - x);\n }\n\n if (dx < min) {\n min = dx;\n closest = i;\n }\n }\n\n closest = !radius || min <= radius ? snapTo[closest] : raw;\n return is2D || closest === raw || _isNumber(raw) ? closest : closest + getUnit(raw);\n });\n},\n random = function random(min, max, roundingIncrement, returnFunction) {\n return _conditionalReturn(_isArray(min) ? !max : roundingIncrement === true ? !!(roundingIncrement = 0) : !returnFunction, function () {\n return _isArray(min) ? min[~~(Math.random() * min.length)] : (roundingIncrement = roundingIncrement || 1e-5) && (returnFunction = roundingIncrement < 1 ? Math.pow(10, (roundingIncrement + \"\").length - 2) : 1) && Math.floor(Math.round((min - roundingIncrement / 2 + Math.random() * (max - min + roundingIncrement * .99)) / roundingIncrement) * roundingIncrement * returnFunction) / returnFunction;\n });\n},\n pipe = function pipe() {\n for (var _len = arguments.length, functions = new Array(_len), _key = 0; _key < _len; _key++) {\n functions[_key] = arguments[_key];\n }\n\n return function (value) {\n return functions.reduce(function (v, f) {\n return f(v);\n }, value);\n };\n},\n unitize = function unitize(func, unit) {\n return function (value) {\n return func(parseFloat(value)) + (unit || getUnit(value));\n };\n},\n normalize = function normalize(min, max, value) {\n return mapRange(min, max, 0, 1, value);\n},\n _wrapArray = function _wrapArray(a, wrapper, value) {\n return _conditionalReturn(value, function (index) {\n return a[~~wrapper(index)];\n });\n},\n wrap = function wrap(min, max, value) {\n // NOTE: wrap() CANNOT be an arrow function! A very odd compiling bug causes problems (unrelated to GSAP).\n var range = max - min;\n return _isArray(min) ? _wrapArray(min, wrap(0, min.length), max) : _conditionalReturn(value, function (value) {\n return (range + (value - min) % range) % range + min;\n });\n},\n wrapYoyo = function wrapYoyo(min, max, value) {\n var range = max - min,\n total = range * 2;\n return _isArray(min) ? _wrapArray(min, wrapYoyo(0, min.length - 1), max) : _conditionalReturn(value, function (value) {\n value = (total + (value - min) % total) % total || 0;\n return min + (value > range ? total - value : value);\n });\n},\n _replaceRandom = function _replaceRandom(value) {\n //replaces all occurrences of random(...) in a string with the calculated random value. can be a range like random(-100, 100, 5) or an array like random([0, 100, 500])\n var prev = 0,\n s = \"\",\n i,\n nums,\n end,\n isArray;\n\n while (~(i = value.indexOf(\"random(\", prev))) {\n end = value.indexOf(\")\", i);\n isArray = value.charAt(i + 7) === \"[\";\n nums = value.substr(i + 7, end - i - 7).match(isArray ? _delimitedValueExp : _strictNumExp);\n s += value.substr(prev, i - prev) + random(isArray ? nums : +nums[0], isArray ? 0 : +nums[1], +nums[2] || 1e-5);\n prev = end + 1;\n }\n\n return s + value.substr(prev, value.length - prev);\n},\n mapRange = function mapRange(inMin, inMax, outMin, outMax, value) {\n var inRange = inMax - inMin,\n outRange = outMax - outMin;\n return _conditionalReturn(value, function (value) {\n return outMin + ((value - inMin) / inRange * outRange || 0);\n });\n},\n interpolate = function interpolate(start, end, progress, mutate) {\n var func = isNaN(start + end) ? 0 : function (p) {\n return (1 - p) * start + p * end;\n };\n\n if (!func) {\n var isString = _isString(start),\n master = {},\n p,\n i,\n interpolators,\n l,\n il;\n\n progress === true && (mutate = 1) && (progress = null);\n\n if (isString) {\n start = {\n p: start\n };\n end = {\n p: end\n };\n } else if (_isArray(start) && !_isArray(end)) {\n interpolators = [];\n l = start.length;\n il = l - 2;\n\n for (i = 1; i < l; i++) {\n interpolators.push(interpolate(start[i - 1], start[i])); //build the interpolators up front as a performance optimization so that when the function is called many times, it can just reuse them.\n }\n\n l--;\n\n func = function func(p) {\n p *= l;\n var i = Math.min(il, ~~p);\n return interpolators[i](p - i);\n };\n\n progress = end;\n } else if (!mutate) {\n start = _merge(_isArray(start) ? [] : {}, start);\n }\n\n if (!interpolators) {\n for (p in end) {\n _addPropTween.call(master, start, p, \"get\", end[p]);\n }\n\n func = function func(p) {\n return _renderPropTweens(p, master) || (isString ? start.p : start);\n };\n }\n }\n\n return _conditionalReturn(progress, func);\n},\n _getLabelInDirection = function _getLabelInDirection(timeline, fromTime, backward) {\n //used for nextLabel() and previousLabel()\n var labels = timeline.labels,\n min = _bigNum,\n p,\n distance,\n label;\n\n for (p in labels) {\n distance = labels[p] - fromTime;\n\n if (distance < 0 === !!backward && distance && min > (distance = Math.abs(distance))) {\n label = p;\n min = distance;\n }\n }\n\n return label;\n},\n _callback = function _callback(animation, type, executeLazyFirst) {\n var v = animation.vars,\n callback = v[type],\n prevContext = _context,\n context = animation._ctx,\n params,\n scope,\n result;\n\n if (!callback) {\n return;\n }\n\n params = v[type + \"Params\"];\n scope = v.callbackScope || animation;\n executeLazyFirst && _lazyTweens.length && _lazyRender(); //in case rendering caused any tweens to lazy-init, we should render them because typically when a timeline finishes, users expect things to have rendered fully. Imagine an onUpdate on a timeline that reports/checks tweened values.\n\n context && (_context = context);\n result = params ? callback.apply(scope, params) : callback.call(scope);\n _context = prevContext;\n return result;\n},\n _interrupt = function _interrupt(animation) {\n _removeFromParent(animation);\n\n animation.scrollTrigger && animation.scrollTrigger.kill(!!_reverting);\n animation.progress() < 1 && _callback(animation, \"onInterrupt\");\n return animation;\n},\n _quickTween,\n _registerPluginQueue = [],\n _createPlugin = function _createPlugin(config) {\n if (!config) return;\n config = !config.name && config[\"default\"] || config; // UMD packaging wraps things oddly, so for example MotionPathHelper becomes {MotionPathHelper:MotionPathHelper, default:MotionPathHelper}.\n\n if (_windowExists() || config.headless) {\n // edge case: some build tools may pass in a null/undefined value\n var name = config.name,\n isFunc = _isFunction(config),\n Plugin = name && !isFunc && config.init ? function () {\n this._props = [];\n } : config,\n //in case someone passes in an object that's not a plugin, like CustomEase\n instanceDefaults = {\n init: _emptyFunc,\n render: _renderPropTweens,\n add: _addPropTween,\n kill: _killPropTweensOf,\n modifier: _addPluginModifier,\n rawVars: 0\n },\n statics = {\n targetTest: 0,\n get: 0,\n getSetter: _getSetter,\n aliases: {},\n register: 0\n };\n\n _wake();\n\n if (config !== Plugin) {\n if (_plugins[name]) {\n return;\n }\n\n _setDefaults(Plugin, _setDefaults(_copyExcluding(config, instanceDefaults), statics)); //static methods\n\n\n _merge(Plugin.prototype, _merge(instanceDefaults, _copyExcluding(config, statics))); //instance methods\n\n\n _plugins[Plugin.prop = name] = Plugin;\n\n if (config.targetTest) {\n _harnessPlugins.push(Plugin);\n\n _reservedProps[name] = 1;\n }\n\n name = (name === \"css\" ? \"CSS\" : name.charAt(0).toUpperCase() + name.substr(1)) + \"Plugin\"; //for the global name. \"motionPath\" should become MotionPathPlugin\n }\n\n _addGlobal(name, Plugin);\n\n config.register && config.register(gsap, Plugin, PropTween);\n } else {\n _registerPluginQueue.push(config);\n }\n},\n\n/*\n * --------------------------------------------------------------------------------------\n * COLORS\n * --------------------------------------------------------------------------------------\n */\n_255 = 255,\n _colorLookup = {\n aqua: [0, _255, _255],\n lime: [0, _255, 0],\n silver: [192, 192, 192],\n black: [0, 0, 0],\n maroon: [128, 0, 0],\n teal: [0, 128, 128],\n blue: [0, 0, _255],\n navy: [0, 0, 128],\n white: [_255, _255, _255],\n olive: [128, 128, 0],\n yellow: [_255, _255, 0],\n orange: [_255, 165, 0],\n gray: [128, 128, 128],\n purple: [128, 0, 128],\n green: [0, 128, 0],\n red: [_255, 0, 0],\n pink: [_255, 192, 203],\n cyan: [0, _255, _255],\n transparent: [_255, _255, _255, 0]\n},\n // possible future idea to replace the hard-coded color name values - put this in the ticker.wake() where we set the _doc:\n// let ctx = _doc.createElement(\"canvas\").getContext(\"2d\");\n// _forEachName(\"aqua,lime,silver,black,maroon,teal,blue,navy,white,olive,yellow,orange,gray,purple,green,red,pink,cyan\", color => {ctx.fillStyle = color; _colorLookup[color] = splitColor(ctx.fillStyle)});\n_hue = function _hue(h, m1, m2) {\n h += h < 0 ? 1 : h > 1 ? -1 : 0;\n return (h * 6 < 1 ? m1 + (m2 - m1) * h * 6 : h < .5 ? m2 : h * 3 < 2 ? m1 + (m2 - m1) * (2 / 3 - h) * 6 : m1) * _255 + .5 | 0;\n},\n splitColor = function splitColor(v, toHSL, forceAlpha) {\n var a = !v ? _colorLookup.black : _isNumber(v) ? [v >> 16, v >> 8 & _255, v & _255] : 0,\n r,\n g,\n b,\n h,\n s,\n l,\n max,\n min,\n d,\n wasHSL;\n\n if (!a) {\n if (v.substr(-1) === \",\") {\n //sometimes a trailing comma is included and we should chop it off (typically from a comma-delimited list of values like a textShadow:\"2px 2px 2px blue, 5px 5px 5px rgb(255,0,0)\" - in this example \"blue,\" has a trailing comma. We could strip it out inside parseComplex() but we'd need to do it to the beginning and ending values plus it wouldn't provide protection from other potential scenarios like if the user passes in a similar value.\n v = v.substr(0, v.length - 1);\n }\n\n if (_colorLookup[v]) {\n a = _colorLookup[v];\n } else if (v.charAt(0) === \"#\") {\n if (v.length < 6) {\n //for shorthand like #9F0 or #9F0F (could have alpha)\n r = v.charAt(1);\n g = v.charAt(2);\n b = v.charAt(3);\n v = \"#\" + r + r + g + g + b + b + (v.length === 5 ? v.charAt(4) + v.charAt(4) : \"\");\n }\n\n if (v.length === 9) {\n // hex with alpha, like #fd5e53ff\n a = parseInt(v.substr(1, 6), 16);\n return [a >> 16, a >> 8 & _255, a & _255, parseInt(v.substr(7), 16) / 255];\n }\n\n v = parseInt(v.substr(1), 16);\n a = [v >> 16, v >> 8 & _255, v & _255];\n } else if (v.substr(0, 3) === \"hsl\") {\n a = wasHSL = v.match(_strictNumExp);\n\n if (!toHSL) {\n h = +a[0] % 360 / 360;\n s = +a[1] / 100;\n l = +a[2] / 100;\n g = l <= .5 ? l * (s + 1) : l + s - l * s;\n r = l * 2 - g;\n a.length > 3 && (a[3] *= 1); //cast as number\n\n a[0] = _hue(h + 1 / 3, r, g);\n a[1] = _hue(h, r, g);\n a[2] = _hue(h - 1 / 3, r, g);\n } else if (~v.indexOf(\"=\")) {\n //if relative values are found, just return the raw strings with the relative prefixes in place.\n a = v.match(_numExp);\n forceAlpha && a.length < 4 && (a[3] = 1);\n return a;\n }\n } else {\n a = v.match(_strictNumExp) || _colorLookup.transparent;\n }\n\n a = a.map(Number);\n }\n\n if (toHSL && !wasHSL) {\n r = a[0] / _255;\n g = a[1] / _255;\n b = a[2] / _255;\n max = Math.max(r, g, b);\n min = Math.min(r, g, b);\n l = (max + min) / 2;\n\n if (max === min) {\n h = s = 0;\n } else {\n d = max - min;\n s = l > 0.5 ? d / (2 - max - min) : d / (max + min);\n h = max === r ? (g - b) / d + (g < b ? 6 : 0) : max === g ? (b - r) / d + 2 : (r - g) / d + 4;\n h *= 60;\n }\n\n a[0] = ~~(h + .5);\n a[1] = ~~(s * 100 + .5);\n a[2] = ~~(l * 100 + .5);\n }\n\n forceAlpha && a.length < 4 && (a[3] = 1);\n return a;\n},\n _colorOrderData = function _colorOrderData(v) {\n // strips out the colors from the string, finds all the numeric slots (with units) and returns an array of those. The Array also has a \"c\" property which is an Array of the index values where the colors belong. This is to help work around issues where there's a mis-matched order of color/numeric data like drop-shadow(#f00 0px 1px 2px) and drop-shadow(0x 1px 2px #f00). This is basically a helper function used in _formatColors()\n var values = [],\n c = [],\n i = -1;\n v.split(_colorExp).forEach(function (v) {\n var a = v.match(_numWithUnitExp) || [];\n values.push.apply(values, a);\n c.push(i += a.length + 1);\n });\n values.c = c;\n return values;\n},\n _formatColors = function _formatColors(s, toHSL, orderMatchData) {\n var result = \"\",\n colors = (s + result).match(_colorExp),\n type = toHSL ? \"hsla(\" : \"rgba(\",\n i = 0,\n c,\n shell,\n d,\n l;\n\n if (!colors) {\n return s;\n }\n\n colors = colors.map(function (color) {\n return (color = splitColor(color, toHSL, 1)) && type + (toHSL ? color[0] + \",\" + color[1] + \"%,\" + color[2] + \"%,\" + color[3] : color.join(\",\")) + \")\";\n });\n\n if (orderMatchData) {\n d = _colorOrderData(s);\n c = orderMatchData.c;\n\n if (c.join(result) !== d.c.join(result)) {\n shell = s.replace(_colorExp, \"1\").split(_numWithUnitExp);\n l = shell.length - 1;\n\n for (; i < l; i++) {\n result += shell[i] + (~c.indexOf(i) ? colors.shift() || type + \"0,0,0,0)\" : (d.length ? d : colors.length ? colors : orderMatchData).shift());\n }\n }\n }\n\n if (!shell) {\n shell = s.split(_colorExp);\n l = shell.length - 1;\n\n for (; i < l; i++) {\n result += shell[i] + colors[i];\n }\n }\n\n return result + shell[l];\n},\n _colorExp = function () {\n var s = \"(?:\\\\b(?:(?:rgb|rgba|hsl|hsla)\\\\(.+?\\\\))|\\\\B#(?:[0-9a-f]{3,4}){1,2}\\\\b\",\n //we'll dynamically build this Regular Expression to conserve file size. After building it, it will be able to find rgb(), rgba(), # (hexadecimal), and named color values like red, blue, purple, etc.,\n p;\n\n for (p in _colorLookup) {\n s += \"|\" + p + \"\\\\b\";\n }\n\n return new RegExp(s + \")\", \"gi\");\n}(),\n _hslExp = /hsl[a]?\\(/,\n _colorStringFilter = function _colorStringFilter(a) {\n var combined = a.join(\" \"),\n toHSL;\n _colorExp.lastIndex = 0;\n\n if (_colorExp.test(combined)) {\n toHSL = _hslExp.test(combined);\n a[1] = _formatColors(a[1], toHSL);\n a[0] = _formatColors(a[0], toHSL, _colorOrderData(a[1])); // make sure the order of numbers/colors match with the END value.\n\n return true;\n }\n},\n\n/*\n * --------------------------------------------------------------------------------------\n * TICKER\n * --------------------------------------------------------------------------------------\n */\n_tickerActive,\n _ticker = function () {\n var _getTime = Date.now,\n _lagThreshold = 500,\n _adjustedLag = 33,\n _startTime = _getTime(),\n _lastUpdate = _startTime,\n _gap = 1000 / 240,\n _nextTime = _gap,\n _listeners = [],\n _id,\n _req,\n _raf,\n _self,\n _delta,\n _i,\n _tick = function _tick(v) {\n var elapsed = _getTime() - _lastUpdate,\n manual = v === true,\n overlap,\n dispatch,\n time,\n frame;\n\n (elapsed > _lagThreshold || elapsed < 0) && (_startTime += elapsed - _adjustedLag);\n _lastUpdate += elapsed;\n time = _lastUpdate - _startTime;\n overlap = time - _nextTime;\n\n if (overlap > 0 || manual) {\n frame = ++_self.frame;\n _delta = time - _self.time * 1000;\n _self.time = time = time / 1000;\n _nextTime += overlap + (overlap >= _gap ? 4 : _gap - overlap);\n dispatch = 1;\n }\n\n manual || (_id = _req(_tick)); //make sure the request is made before we dispatch the \"tick\" event so that timing is maintained. Otherwise, if processing the \"tick\" requires a bunch of time (like 15ms) and we're using a setTimeout() that's based on 16.7ms, it'd technically take 31.7ms between frames otherwise.\n\n if (dispatch) {\n for (_i = 0; _i < _listeners.length; _i++) {\n // use _i and check _listeners.length instead of a variable because a listener could get removed during the loop, and if that happens to an element less than the current index, it'd throw things off in the loop.\n _listeners[_i](time, _delta, frame, v);\n }\n }\n };\n\n _self = {\n time: 0,\n frame: 0,\n tick: function tick() {\n _tick(true);\n },\n deltaRatio: function deltaRatio(fps) {\n return _delta / (1000 / (fps || 60));\n },\n wake: function wake() {\n if (_coreReady) {\n if (!_coreInitted && _windowExists()) {\n _win = _coreInitted = window;\n _doc = _win.document || {};\n _globals.gsap = gsap;\n (_win.gsapVersions || (_win.gsapVersions = [])).push(gsap.version);\n\n _install(_installScope || _win.GreenSockGlobals || !_win.gsap && _win || {});\n\n _registerPluginQueue.forEach(_createPlugin);\n }\n\n _raf = typeof requestAnimationFrame !== \"undefined\" && requestAnimationFrame;\n _id && _self.sleep();\n\n _req = _raf || function (f) {\n return setTimeout(f, _nextTime - _self.time * 1000 + 1 | 0);\n };\n\n _tickerActive = 1;\n\n _tick(2);\n }\n },\n sleep: function sleep() {\n (_raf ? cancelAnimationFrame : clearTimeout)(_id);\n _tickerActive = 0;\n _req = _emptyFunc;\n },\n lagSmoothing: function lagSmoothing(threshold, adjustedLag) {\n _lagThreshold = threshold || Infinity; // zero should be interpreted as basically unlimited\n\n _adjustedLag = Math.min(adjustedLag || 33, _lagThreshold);\n },\n fps: function fps(_fps) {\n _gap = 1000 / (_fps || 240);\n _nextTime = _self.time * 1000 + _gap;\n },\n add: function add(callback, once, prioritize) {\n var func = once ? function (t, d, f, v) {\n callback(t, d, f, v);\n\n _self.remove(func);\n } : callback;\n\n _self.remove(callback);\n\n _listeners[prioritize ? \"unshift\" : \"push\"](func);\n\n _wake();\n\n return func;\n },\n remove: function remove(callback, i) {\n ~(i = _listeners.indexOf(callback)) && _listeners.splice(i, 1) && _i >= i && _i--;\n },\n _listeners: _listeners\n };\n return _self;\n}(),\n _wake = function _wake() {\n return !_tickerActive && _ticker.wake();\n},\n //also ensures the core classes are initialized.\n\n/*\n* -------------------------------------------------\n* EASING\n* -------------------------------------------------\n*/\n_easeMap = {},\n _customEaseExp = /^[\\d.\\-M][\\d.\\-,\\s]/,\n _quotesExp = /[\"']/g,\n _parseObjectInString = function _parseObjectInString(value) {\n //takes a string like \"{wiggles:10, type:anticipate})\" and turns it into a real object. Notice it ends in \")\" and includes the {} wrappers. This is because we only use this function for parsing ease configs and prioritized optimization rather than reusability.\n var obj = {},\n split = value.substr(1, value.length - 3).split(\":\"),\n key = split[0],\n i = 1,\n l = split.length,\n index,\n val,\n parsedVal;\n\n for (; i < l; i++) {\n val = split[i];\n index = i !== l - 1 ? val.lastIndexOf(\",\") : val.length;\n parsedVal = val.substr(0, index);\n obj[key] = isNaN(parsedVal) ? parsedVal.replace(_quotesExp, \"\").trim() : +parsedVal;\n key = val.substr(index + 1).trim();\n }\n\n return obj;\n},\n _valueInParentheses = function _valueInParentheses(value) {\n var open = value.indexOf(\"(\") + 1,\n close = value.indexOf(\")\"),\n nested = value.indexOf(\"(\", open);\n return value.substring(open, ~nested && nested < close ? value.indexOf(\")\", close + 1) : close);\n},\n _configEaseFromString = function _configEaseFromString(name) {\n //name can be a string like \"elastic.out(1,0.5)\", and pass in _easeMap as obj and it'll parse it out and call the actual function like _easeMap.Elastic.easeOut.config(1,0.5). It will also parse custom ease strings as long as CustomEase is loaded and registered (internally as _easeMap._CE).\n var split = (name + \"\").split(\"(\"),\n ease = _easeMap[split[0]];\n return ease && split.length > 1 && ease.config ? ease.config.apply(null, ~name.indexOf(\"{\") ? [_parseObjectInString(split[1])] : _valueInParentheses(name).split(\",\").map(_numericIfPossible)) : _easeMap._CE && _customEaseExp.test(name) ? _easeMap._CE(\"\", name) : ease;\n},\n _invertEase = function _invertEase(ease) {\n return function (p) {\n return 1 - ease(1 - p);\n };\n},\n // allow yoyoEase to be set in children and have those affected when the parent/ancestor timeline yoyos.\n_propagateYoyoEase = function _propagateYoyoEase(timeline, isYoyo) {\n var child = timeline._first,\n ease;\n\n while (child) {\n if (child instanceof Timeline) {\n _propagateYoyoEase(child, isYoyo);\n } else if (child.vars.yoyoEase && (!child._yoyo || !child._repeat) && child._yoyo !== isYoyo) {\n if (child.timeline) {\n _propagateYoyoEase(child.timeline, isYoyo);\n } else {\n ease = child._ease;\n child._ease = child._yEase;\n child._yEase = ease;\n child._yoyo = isYoyo;\n }\n }\n\n child = child._next;\n }\n},\n _parseEase = function _parseEase(ease, defaultEase) {\n return !ease ? defaultEase : (_isFunction(ease) ? ease : _easeMap[ease] || _configEaseFromString(ease)) || defaultEase;\n},\n _insertEase = function _insertEase(names, easeIn, easeOut, easeInOut) {\n if (easeOut === void 0) {\n easeOut = function easeOut(p) {\n return 1 - easeIn(1 - p);\n };\n }\n\n if (easeInOut === void 0) {\n easeInOut = function easeInOut(p) {\n return p < .5 ? easeIn(p * 2) / 2 : 1 - easeIn((1 - p) * 2) / 2;\n };\n }\n\n var ease = {\n easeIn: easeIn,\n easeOut: easeOut,\n easeInOut: easeInOut\n },\n lowercaseName;\n\n _forEachName(names, function (name) {\n _easeMap[name] = _globals[name] = ease;\n _easeMap[lowercaseName = name.toLowerCase()] = easeOut;\n\n for (var p in ease) {\n _easeMap[lowercaseName + (p === \"easeIn\" ? \".in\" : p === \"easeOut\" ? \".out\" : \".inOut\")] = _easeMap[name + \".\" + p] = ease[p];\n }\n });\n\n return ease;\n},\n _easeInOutFromOut = function _easeInOutFromOut(easeOut) {\n return function (p) {\n return p < .5 ? (1 - easeOut(1 - p * 2)) / 2 : .5 + easeOut((p - .5) * 2) / 2;\n };\n},\n _configElastic = function _configElastic(type, amplitude, period) {\n var p1 = amplitude >= 1 ? amplitude : 1,\n //note: if amplitude is < 1, we simply adjust the period for a more natural feel. Otherwise the math doesn't work right and the curve starts at 1.\n p2 = (period || (type ? .3 : .45)) / (amplitude < 1 ? amplitude : 1),\n p3 = p2 / _2PI * (Math.asin(1 / p1) || 0),\n easeOut = function easeOut(p) {\n return p === 1 ? 1 : p1 * Math.pow(2, -10 * p) * _sin((p - p3) * p2) + 1;\n },\n ease = type === \"out\" ? easeOut : type === \"in\" ? function (p) {\n return 1 - easeOut(1 - p);\n } : _easeInOutFromOut(easeOut);\n\n p2 = _2PI / p2; //precalculate to optimize\n\n ease.config = function (amplitude, period) {\n return _configElastic(type, amplitude, period);\n };\n\n return ease;\n},\n _configBack = function _configBack(type, overshoot) {\n if (overshoot === void 0) {\n overshoot = 1.70158;\n }\n\n var easeOut = function easeOut(p) {\n return p ? --p * p * ((overshoot + 1) * p + overshoot) + 1 : 0;\n },\n ease = type === \"out\" ? easeOut : type === \"in\" ? function (p) {\n return 1 - easeOut(1 - p);\n } : _easeInOutFromOut(easeOut);\n\n ease.config = function (overshoot) {\n return _configBack(type, overshoot);\n };\n\n return ease;\n}; // a cheaper (kb and cpu) but more mild way to get a parameterized weighted ease by feeding in a value between -1 (easeIn) and 1 (easeOut) where 0 is linear.\n// _weightedEase = ratio => {\n// \tlet y = 0.5 + ratio / 2;\n// \treturn p => (2 * (1 - p) * p * y + p * p);\n// },\n// a stronger (but more expensive kb/cpu) parameterized weighted ease that lets you feed in a value between -1 (easeIn) and 1 (easeOut) where 0 is linear.\n// _weightedEaseStrong = ratio => {\n// \tratio = .5 + ratio / 2;\n// \tlet o = 1 / 3 * (ratio < .5 ? ratio : 1 - ratio),\n// \t\tb = ratio - o,\n// \t\tc = ratio + o;\n// \treturn p => p === 1 ? p : 3 * b * (1 - p) * (1 - p) * p + 3 * c * (1 - p) * p * p + p * p * p;\n// };\n\n\n_forEachName(\"Linear,Quad,Cubic,Quart,Quint,Strong\", function (name, i) {\n var power = i < 5 ? i + 1 : i;\n\n _insertEase(name + \",Power\" + (power - 1), i ? function (p) {\n return Math.pow(p, power);\n } : function (p) {\n return p;\n }, function (p) {\n return 1 - Math.pow(1 - p, power);\n }, function (p) {\n return p < .5 ? Math.pow(p * 2, power) / 2 : 1 - Math.pow((1 - p) * 2, power) / 2;\n });\n});\n\n_easeMap.Linear.easeNone = _easeMap.none = _easeMap.Linear.easeIn;\n\n_insertEase(\"Elastic\", _configElastic(\"in\"), _configElastic(\"out\"), _configElastic());\n\n(function (n, c) {\n var n1 = 1 / c,\n n2 = 2 * n1,\n n3 = 2.5 * n1,\n easeOut = function easeOut(p) {\n return p < n1 ? n * p * p : p < n2 ? n * Math.pow(p - 1.5 / c, 2) + .75 : p < n3 ? n * (p -= 2.25 / c) * p + .9375 : n * Math.pow(p - 2.625 / c, 2) + .984375;\n };\n\n _insertEase(\"Bounce\", function (p) {\n return 1 - easeOut(1 - p);\n }, easeOut);\n})(7.5625, 2.75);\n\n_insertEase(\"Expo\", function (p) {\n return p ? Math.pow(2, 10 * (p - 1)) : 0;\n});\n\n_insertEase(\"Circ\", function (p) {\n return -(_sqrt(1 - p * p) - 1);\n});\n\n_insertEase(\"Sine\", function (p) {\n return p === 1 ? 1 : -_cos(p * _HALF_PI) + 1;\n});\n\n_insertEase(\"Back\", _configBack(\"in\"), _configBack(\"out\"), _configBack());\n\n_easeMap.SteppedEase = _easeMap.steps = _globals.SteppedEase = {\n config: function config(steps, immediateStart) {\n if (steps === void 0) {\n steps = 1;\n }\n\n var p1 = 1 / steps,\n p2 = steps + (immediateStart ? 0 : 1),\n p3 = immediateStart ? 1 : 0,\n max = 1 - _tinyNum;\n return function (p) {\n return ((p2 * _clamp(0, max, p) | 0) + p3) * p1;\n };\n }\n};\n_defaults.ease = _easeMap[\"quad.out\"];\n\n_forEachName(\"onComplete,onUpdate,onStart,onRepeat,onReverseComplete,onInterrupt\", function (name) {\n return _callbackNames += name + \",\" + name + \"Params,\";\n});\n/*\n * --------------------------------------------------------------------------------------\n * CACHE\n * --------------------------------------------------------------------------------------\n */\n\n\nexport var GSCache = function GSCache(target, harness) {\n this.id = _gsID++;\n target._gsap = this;\n this.target = target;\n this.harness = harness;\n this.get = harness ? harness.get : _getProperty;\n this.set = harness ? harness.getSetter : _getSetter;\n};\n/*\n * --------------------------------------------------------------------------------------\n * ANIMATION\n * --------------------------------------------------------------------------------------\n */\n\nexport var Animation = /*#__PURE__*/function () {\n function Animation(vars) {\n this.vars = vars;\n this._delay = +vars.delay || 0;\n\n if (this._repeat = vars.repeat === Infinity ? -2 : vars.repeat || 0) {\n // TODO: repeat: Infinity on a timeline's children must flag that timeline internally and affect its totalDuration, otherwise it'll stop in the negative direction when reaching the start.\n this._rDelay = vars.repeatDelay || 0;\n this._yoyo = !!vars.yoyo || !!vars.yoyoEase;\n }\n\n this._ts = 1;\n\n _setDuration(this, +vars.duration, 1, 1);\n\n this.data = vars.data;\n\n if (_context) {\n this._ctx = _context;\n\n _context.data.push(this);\n }\n\n _tickerActive || _ticker.wake();\n }\n\n var _proto = Animation.prototype;\n\n _proto.delay = function delay(value) {\n if (value || value === 0) {\n this.parent && this.parent.smoothChildTiming && this.startTime(this._start + value - this._delay);\n this._delay = value;\n return this;\n }\n\n return this._delay;\n };\n\n _proto.duration = function duration(value) {\n return arguments.length ? this.totalDuration(this._repeat > 0 ? value + (value + this._rDelay) * this._repeat : value) : this.totalDuration() && this._dur;\n };\n\n _proto.totalDuration = function totalDuration(value) {\n if (!arguments.length) {\n return this._tDur;\n }\n\n this._dirty = 0;\n return _setDuration(this, this._repeat < 0 ? value : (value - this._repeat * this._rDelay) / (this._repeat + 1));\n };\n\n _proto.totalTime = function totalTime(_totalTime, suppressEvents) {\n _wake();\n\n if (!arguments.length) {\n return this._tTime;\n }\n\n var parent = this._dp;\n\n if (parent && parent.smoothChildTiming && this._ts) {\n _alignPlayhead(this, _totalTime);\n\n !parent._dp || parent.parent || _postAddChecks(parent, this); // edge case: if this is a child of a timeline that already completed, for example, we must re-activate the parent.\n //in case any of the ancestor timelines had completed but should now be enabled, we should reset their totalTime() which will also ensure that they're lined up properly and enabled. Skip for animations that are on the root (wasteful). Example: a TimelineLite.exportRoot() is performed when there's a paused tween on the root, the export will not complete until that tween is unpaused, but imagine a child gets restarted later, after all [unpaused] tweens have completed. The start of that child would get pushed out, but one of the ancestors may have completed.\n\n while (parent && parent.parent) {\n if (parent.parent._time !== parent._start + (parent._ts >= 0 ? parent._tTime / parent._ts : (parent.totalDuration() - parent._tTime) / -parent._ts)) {\n parent.totalTime(parent._tTime, true);\n }\n\n parent = parent.parent;\n }\n\n if (!this.parent && this._dp.autoRemoveChildren && (this._ts > 0 && _totalTime < this._tDur || this._ts < 0 && _totalTime > 0 || !this._tDur && !_totalTime)) {\n //if the animation doesn't have a parent, put it back into its last parent (recorded as _dp for exactly cases like this). Limit to parents with autoRemoveChildren (like globalTimeline) so that if the user manually removes an animation from a timeline and then alters its playhead, it doesn't get added back in.\n _addToTimeline(this._dp, this, this._start - this._delay);\n }\n }\n\n if (this._tTime !== _totalTime || !this._dur && !suppressEvents || this._initted && Math.abs(this._zTime) === _tinyNum || !_totalTime && !this._initted && (this.add || this._ptLookup)) {\n // check for _ptLookup on a Tween instance to ensure it has actually finished being instantiated, otherwise if this.reverse() gets called in the Animation constructor, it could trigger a render() here even though the _targets weren't populated, thus when _init() is called there won't be any PropTweens (it'll act like the tween is non-functional)\n this._ts || (this._pTime = _totalTime); // otherwise, if an animation is paused, then the playhead is moved back to zero, then resumed, it'd revert back to the original time at the pause\n //if (!this._lock) { // avoid endless recursion (not sure we need this yet or if it's worth the performance hit)\n // this._lock = 1;\n\n _lazySafeRender(this, _totalTime, suppressEvents); // this._lock = 0;\n //}\n\n }\n\n return this;\n };\n\n _proto.time = function time(value, suppressEvents) {\n return arguments.length ? this.totalTime(Math.min(this.totalDuration(), value + _elapsedCycleDuration(this)) % (this._dur + this._rDelay) || (value ? this._dur : 0), suppressEvents) : this._time; // note: if the modulus results in 0, the playhead could be exactly at the end or the beginning, and we always defer to the END with a non-zero value, otherwise if you set the time() to the very end (duration()), it would render at the START!\n };\n\n _proto.totalProgress = function totalProgress(value, suppressEvents) {\n return arguments.length ? this.totalTime(this.totalDuration() * value, suppressEvents) : this.totalDuration() ? Math.min(1, this._tTime / this._tDur) : this.rawTime() > 0 ? 1 : 0;\n };\n\n _proto.progress = function progress(value, suppressEvents) {\n return arguments.length ? this.totalTime(this.duration() * (this._yoyo && !(this.iteration() & 1) ? 1 - value : value) + _elapsedCycleDuration(this), suppressEvents) : this.duration() ? Math.min(1, this._time / this._dur) : this.rawTime() > 0 ? 1 : 0;\n };\n\n _proto.iteration = function iteration(value, suppressEvents) {\n var cycleDuration = this.duration() + this._rDelay;\n\n return arguments.length ? this.totalTime(this._time + (value - 1) * cycleDuration, suppressEvents) : this._repeat ? _animationCycle(this._tTime, cycleDuration) + 1 : 1;\n } // potential future addition:\n // isPlayingBackwards() {\n // \tlet animation = this,\n // \t\torientation = 1; // 1 = forward, -1 = backward\n // \twhile (animation) {\n // \t\torientation *= animation.reversed() || (animation.repeat() && !(animation.iteration() & 1)) ? -1 : 1;\n // \t\tanimation = animation.parent;\n // \t}\n // \treturn orientation < 0;\n // }\n ;\n\n _proto.timeScale = function timeScale(value, suppressEvents) {\n if (!arguments.length) {\n return this._rts === -_tinyNum ? 0 : this._rts; // recorded timeScale. Special case: if someone calls reverse() on an animation with timeScale of 0, we assign it -_tinyNum to remember it's reversed.\n }\n\n if (this._rts === value) {\n return this;\n }\n\n var tTime = this.parent && this._ts ? _parentToChildTotalTime(this.parent._time, this) : this._tTime; // make sure to do the parentToChildTotalTime() BEFORE setting the new _ts because the old one must be used in that calculation.\n // future addition? Up side: fast and minimal file size. Down side: only works on this animation; if a timeline is reversed, for example, its childrens' onReverse wouldn't get called.\n //(+value < 0 && this._rts >= 0) && _callback(this, \"onReverse\", true);\n // prioritize rendering where the parent's playhead lines up instead of this._tTime because there could be a tween that's animating another tween's timeScale in the same rendering loop (same parent), thus if the timeScale tween renders first, it would alter _start BEFORE _tTime was set on that tick (in the rendering loop), effectively freezing it until the timeScale tween finishes.\n\n this._rts = +value || 0;\n this._ts = this._ps || value === -_tinyNum ? 0 : this._rts; // _ts is the functional timeScale which would be 0 if the animation is paused.\n\n this.totalTime(_clamp(-Math.abs(this._delay), this._tDur, tTime), suppressEvents !== false);\n\n _setEnd(this); // if parent.smoothChildTiming was false, the end time didn't get updated in the _alignPlayhead() method, so do it here.\n\n\n return _recacheAncestors(this);\n };\n\n _proto.paused = function paused(value) {\n if (!arguments.length) {\n return this._ps;\n }\n\n if (this._ps !== value) {\n this._ps = value;\n\n if (value) {\n this._pTime = this._tTime || Math.max(-this._delay, this.rawTime()); // if the pause occurs during the delay phase, make sure that's factored in when resuming.\n\n this._ts = this._act = 0; // _ts is the functional timeScale, so a paused tween would effectively have a timeScale of 0. We record the \"real\" timeScale as _rts (recorded time scale)\n } else {\n _wake();\n\n this._ts = this._rts; //only defer to _pTime (pauseTime) if tTime is zero. Remember, someone could pause() an animation, then scrub the playhead and resume(). If the parent doesn't have smoothChildTiming, we render at the rawTime() because the startTime won't get updated.\n\n this.totalTime(this.parent && !this.parent.smoothChildTiming ? this.rawTime() : this._tTime || this._pTime, this.progress() === 1 && Math.abs(this._zTime) !== _tinyNum && (this._tTime -= _tinyNum)); // edge case: animation.progress(1).pause().play() wouldn't render again because the playhead is already at the end, but the call to totalTime() below will add it back to its parent...and not remove it again (since removing only happens upon rendering at a new time). Offsetting the _tTime slightly is done simply to cause the final render in totalTime() that'll pop it off its timeline (if autoRemoveChildren is true, of course). Check to make sure _zTime isn't -_tinyNum to avoid an edge case where the playhead is pushed to the end but INSIDE a tween/callback, the timeline itself is paused thus halting rendering and leaving a few unrendered. When resuming, it wouldn't render those otherwise.\n }\n }\n\n return this;\n };\n\n _proto.startTime = function startTime(value) {\n if (arguments.length) {\n this._start = value;\n var parent = this.parent || this._dp;\n parent && (parent._sort || !this.parent) && _addToTimeline(parent, this, value - this._delay);\n return this;\n }\n\n return this._start;\n };\n\n _proto.endTime = function endTime(includeRepeats) {\n return this._start + (_isNotFalse(includeRepeats) ? this.totalDuration() : this.duration()) / Math.abs(this._ts || 1);\n };\n\n _proto.rawTime = function rawTime(wrapRepeats) {\n var parent = this.parent || this._dp; // _dp = detached parent\n\n return !parent ? this._tTime : wrapRepeats && (!this._ts || this._repeat && this._time && this.totalProgress() < 1) ? this._tTime % (this._dur + this._rDelay) : !this._ts ? this._tTime : _parentToChildTotalTime(parent.rawTime(wrapRepeats), this);\n };\n\n _proto.revert = function revert(config) {\n if (config === void 0) {\n config = _revertConfig;\n }\n\n var prevIsReverting = _reverting;\n _reverting = config;\n\n if (this._initted || this._startAt) {\n this.timeline && this.timeline.revert(config);\n this.totalTime(-0.01, config.suppressEvents);\n }\n\n this.data !== \"nested\" && config.kill !== false && this.kill();\n _reverting = prevIsReverting;\n return this;\n };\n\n _proto.globalTime = function globalTime(rawTime) {\n var animation = this,\n time = arguments.length ? rawTime : animation.rawTime();\n\n while (animation) {\n time = animation._start + time / (Math.abs(animation._ts) || 1);\n animation = animation._dp;\n }\n\n return !this.parent && this._sat ? this._sat.globalTime(rawTime) : time; // the _startAt tweens for .fromTo() and .from() that have immediateRender should always be FIRST in the timeline (important for context.revert()). \"_sat\" stands for _startAtTween, referring to the parent tween that created the _startAt. We must discern if that tween had immediateRender so that we can know whether or not to prioritize it in revert().\n };\n\n _proto.repeat = function repeat(value) {\n if (arguments.length) {\n this._repeat = value === Infinity ? -2 : value;\n return _onUpdateTotalDuration(this);\n }\n\n return this._repeat === -2 ? Infinity : this._repeat;\n };\n\n _proto.repeatDelay = function repeatDelay(value) {\n if (arguments.length) {\n var time = this._time;\n this._rDelay = value;\n\n _onUpdateTotalDuration(this);\n\n return time ? this.time(time) : this;\n }\n\n return this._rDelay;\n };\n\n _proto.yoyo = function yoyo(value) {\n if (arguments.length) {\n this._yoyo = value;\n return this;\n }\n\n return this._yoyo;\n };\n\n _proto.seek = function seek(position, suppressEvents) {\n return this.totalTime(_parsePosition(this, position), _isNotFalse(suppressEvents));\n };\n\n _proto.restart = function restart(includeDelay, suppressEvents) {\n return this.play().totalTime(includeDelay ? -this._delay : 0, _isNotFalse(suppressEvents));\n };\n\n _proto.play = function play(from, suppressEvents) {\n from != null && this.seek(from, suppressEvents);\n return this.reversed(false).paused(false);\n };\n\n _proto.reverse = function reverse(from, suppressEvents) {\n from != null && this.seek(from || this.totalDuration(), suppressEvents);\n return this.reversed(true).paused(false);\n };\n\n _proto.pause = function pause(atTime, suppressEvents) {\n atTime != null && this.seek(atTime, suppressEvents);\n return this.paused(true);\n };\n\n _proto.resume = function resume() {\n return this.paused(false);\n };\n\n _proto.reversed = function reversed(value) {\n if (arguments.length) {\n !!value !== this.reversed() && this.timeScale(-this._rts || (value ? -_tinyNum : 0)); // in case timeScale is zero, reversing would have no effect so we use _tinyNum.\n\n return this;\n }\n\n return this._rts < 0;\n };\n\n _proto.invalidate = function invalidate() {\n this._initted = this._act = 0;\n this._zTime = -_tinyNum;\n return this;\n };\n\n _proto.isActive = function isActive() {\n var parent = this.parent || this._dp,\n start = this._start,\n rawTime;\n return !!(!parent || this._ts && this._initted && parent.isActive() && (rawTime = parent.rawTime(true)) >= start && rawTime < this.endTime(true) - _tinyNum);\n };\n\n _proto.eventCallback = function eventCallback(type, callback, params) {\n var vars = this.vars;\n\n if (arguments.length > 1) {\n if (!callback) {\n delete vars[type];\n } else {\n vars[type] = callback;\n params && (vars[type + \"Params\"] = params);\n type === \"onUpdate\" && (this._onUpdate = callback);\n }\n\n return this;\n }\n\n return vars[type];\n };\n\n _proto.then = function then(onFulfilled) {\n var self = this;\n return new Promise(function (resolve) {\n var f = _isFunction(onFulfilled) ? onFulfilled : _passThrough,\n _resolve = function _resolve() {\n var _then = self.then;\n self.then = null; // temporarily null the then() method to avoid an infinite loop (see https://github.com/greensock/GSAP/issues/322)\n\n _isFunction(f) && (f = f(self)) && (f.then || f === self) && (self.then = _then);\n resolve(f);\n self.then = _then;\n };\n\n if (self._initted && self.totalProgress() === 1 && self._ts >= 0 || !self._tTime && self._ts < 0) {\n _resolve();\n } else {\n self._prom = _resolve;\n }\n });\n };\n\n _proto.kill = function kill() {\n _interrupt(this);\n };\n\n return Animation;\n}();\n\n_setDefaults(Animation.prototype, {\n _time: 0,\n _start: 0,\n _end: 0,\n _tTime: 0,\n _tDur: 0,\n _dirty: 0,\n _repeat: 0,\n _yoyo: false,\n parent: null,\n _initted: false,\n _rDelay: 0,\n _ts: 1,\n _dp: 0,\n ratio: 0,\n _zTime: -_tinyNum,\n _prom: 0,\n _ps: false,\n _rts: 1\n});\n/*\n * -------------------------------------------------\n * TIMELINE\n * -------------------------------------------------\n */\n\n\nexport var Timeline = /*#__PURE__*/function (_Animation) {\n _inheritsLoose(Timeline, _Animation);\n\n function Timeline(vars, position) {\n var _this;\n\n if (vars === void 0) {\n vars = {};\n }\n\n _this = _Animation.call(this, vars) || this;\n _this.labels = {};\n _this.smoothChildTiming = !!vars.smoothChildTiming;\n _this.autoRemoveChildren = !!vars.autoRemoveChildren;\n _this._sort = _isNotFalse(vars.sortChildren);\n _globalTimeline && _addToTimeline(vars.parent || _globalTimeline, _assertThisInitialized(_this), position);\n vars.reversed && _this.reverse();\n vars.paused && _this.paused(true);\n vars.scrollTrigger && _scrollTrigger(_assertThisInitialized(_this), vars.scrollTrigger);\n return _this;\n }\n\n var _proto2 = Timeline.prototype;\n\n _proto2.to = function to(targets, vars, position) {\n _createTweenType(0, arguments, this);\n\n return this;\n };\n\n _proto2.from = function from(targets, vars, position) {\n _createTweenType(1, arguments, this);\n\n return this;\n };\n\n _proto2.fromTo = function fromTo(targets, fromVars, toVars, position) {\n _createTweenType(2, arguments, this);\n\n return this;\n };\n\n _proto2.set = function set(targets, vars, position) {\n vars.duration = 0;\n vars.parent = this;\n _inheritDefaults(vars).repeatDelay || (vars.repeat = 0);\n vars.immediateRender = !!vars.immediateRender;\n new Tween(targets, vars, _parsePosition(this, position), 1);\n return this;\n };\n\n _proto2.call = function call(callback, params, position) {\n return _addToTimeline(this, Tween.delayedCall(0, callback, params), position);\n } //ONLY for backward compatibility! Maybe delete?\n ;\n\n _proto2.staggerTo = function staggerTo(targets, duration, vars, stagger, position, onCompleteAll, onCompleteAllParams) {\n vars.duration = duration;\n vars.stagger = vars.stagger || stagger;\n vars.onComplete = onCompleteAll;\n vars.onCompleteParams = onCompleteAllParams;\n vars.parent = this;\n new Tween(targets, vars, _parsePosition(this, position));\n return this;\n };\n\n _proto2.staggerFrom = function staggerFrom(targets, duration, vars, stagger, position, onCompleteAll, onCompleteAllParams) {\n vars.runBackwards = 1;\n _inheritDefaults(vars).immediateRender = _isNotFalse(vars.immediateRender);\n return this.staggerTo(targets, duration, vars, stagger, position, onCompleteAll, onCompleteAllParams);\n };\n\n _proto2.staggerFromTo = function staggerFromTo(targets, duration, fromVars, toVars, stagger, position, onCompleteAll, onCompleteAllParams) {\n toVars.startAt = fromVars;\n _inheritDefaults(toVars).immediateRender = _isNotFalse(toVars.immediateRender);\n return this.staggerTo(targets, duration, toVars, stagger, position, onCompleteAll, onCompleteAllParams);\n };\n\n _proto2.render = function render(totalTime, suppressEvents, force) {\n var prevTime = this._time,\n tDur = this._dirty ? this.totalDuration() : this._tDur,\n dur = this._dur,\n tTime = totalTime <= 0 ? 0 : _roundPrecise(totalTime),\n // if a paused timeline is resumed (or its _start is updated for another reason...which rounds it), that could result in the playhead shifting a **tiny** amount and a zero-duration child at that spot may get rendered at a different ratio, like its totalTime in render() may be 1e-17 instead of 0, for example.\n crossingStart = this._zTime < 0 !== totalTime < 0 && (this._initted || !dur),\n time,\n child,\n next,\n iteration,\n cycleDuration,\n prevPaused,\n pauseTween,\n timeScale,\n prevStart,\n prevIteration,\n yoyo,\n isYoyo;\n this !== _globalTimeline && tTime > tDur && totalTime >= 0 && (tTime = tDur);\n\n if (tTime !== this._tTime || force || crossingStart) {\n if (prevTime !== this._time && dur) {\n //if totalDuration() finds a child with a negative startTime and smoothChildTiming is true, things get shifted around internally so we need to adjust the time accordingly. For example, if a tween starts at -30 we must shift EVERYTHING forward 30 seconds and move this timeline's startTime backward by 30 seconds so that things align with the playhead (no jump).\n tTime += this._time - prevTime;\n totalTime += this._time - prevTime;\n }\n\n time = tTime;\n prevStart = this._start;\n timeScale = this._ts;\n prevPaused = !timeScale;\n\n if (crossingStart) {\n dur || (prevTime = this._zTime); //when the playhead arrives at EXACTLY time 0 (right on top) of a zero-duration timeline, we need to discern if events are suppressed so that when the playhead moves again (next time), it'll trigger the callback. If events are NOT suppressed, obviously the callback would be triggered in this render. Basically, the callback should fire either when the playhead ARRIVES or LEAVES this exact spot, not both. Imagine doing a timeline.seek(0) and there's a callback that sits at 0. Since events are suppressed on that seek() by default, nothing will fire, but when the playhead moves off of that position, the callback should fire. This behavior is what people intuitively expect.\n\n (totalTime || !suppressEvents) && (this._zTime = totalTime);\n }\n\n if (this._repeat) {\n //adjust the time for repeats and yoyos\n yoyo = this._yoyo;\n cycleDuration = dur + this._rDelay;\n\n if (this._repeat < -1 && totalTime < 0) {\n return this.totalTime(cycleDuration * 100 + totalTime, suppressEvents, force);\n }\n\n time = _roundPrecise(tTime % cycleDuration); //round to avoid floating point errors. (4 % 0.8 should be 0 but some browsers report it as 0.79999999!)\n\n if (tTime === tDur) {\n // the tDur === tTime is for edge cases where there's a lengthy decimal on the duration and it may reach the very end but the time is rendered as not-quite-there (remember, tDur is rounded to 4 decimals whereas dur isn't)\n iteration = this._repeat;\n time = dur;\n } else {\n iteration = ~~(tTime / cycleDuration);\n\n if (iteration && iteration === tTime / cycleDuration) {\n time = dur;\n iteration--;\n }\n\n time > dur && (time = dur);\n }\n\n prevIteration = _animationCycle(this._tTime, cycleDuration);\n !prevTime && this._tTime && prevIteration !== iteration && this._tTime - prevIteration * cycleDuration - this._dur <= 0 && (prevIteration = iteration); // edge case - if someone does addPause() at the very beginning of a repeating timeline, that pause is technically at the same spot as the end which causes this._time to get set to 0 when the totalTime would normally place the playhead at the end. See https://gsap.com/forums/topic/23823-closing-nav-animation-not-working-on-ie-and-iphone-6-maybe-other-older-browser/?tab=comments#comment-113005 also, this._tTime - prevIteration * cycleDuration - this._dur <= 0 just checks to make sure it wasn't previously in the \"repeatDelay\" portion\n\n if (yoyo && iteration & 1) {\n time = dur - time;\n isYoyo = 1;\n }\n /*\n make sure children at the end/beginning of the timeline are rendered properly. If, for example,\n a 3-second long timeline rendered at 2.9 seconds previously, and now renders at 3.2 seconds (which\n would get translated to 2.8 seconds if the timeline yoyos or 0.2 seconds if it just repeats), there\n could be a callback or a short tween that's at 2.95 or 3 seconds in which wouldn't render. So\n we need to push the timeline to the end (and/or beginning depending on its yoyo value). Also we must\n ensure that zero-duration tweens at the very beginning or end of the Timeline work.\n */\n\n\n if (iteration !== prevIteration && !this._lock) {\n var rewinding = yoyo && prevIteration & 1,\n doesWrap = rewinding === (yoyo && iteration & 1);\n iteration < prevIteration && (rewinding = !rewinding);\n prevTime = rewinding ? 0 : tTime % dur ? dur : tTime; // if the playhead is landing exactly at the end of an iteration, use that totalTime rather than only the duration, otherwise it'll skip the 2nd render since it's effectively at the same time.\n\n this._lock = 1;\n this.render(prevTime || (isYoyo ? 0 : _roundPrecise(iteration * cycleDuration)), suppressEvents, !dur)._lock = 0;\n this._tTime = tTime; // if a user gets the iteration() inside the onRepeat, for example, it should be accurate.\n\n !suppressEvents && this.parent && _callback(this, \"onRepeat\");\n this.vars.repeatRefresh && !isYoyo && (this.invalidate()._lock = 1);\n\n if (prevTime && prevTime !== this._time || prevPaused !== !this._ts || this.vars.onRepeat && !this.parent && !this._act) {\n // if prevTime is 0 and we render at the very end, _time will be the end, thus won't match. So in this edge case, prevTime won't match _time but that's okay. If it gets killed in the onRepeat, eject as well.\n return this;\n }\n\n dur = this._dur; // in case the duration changed in the onRepeat\n\n tDur = this._tDur;\n\n if (doesWrap) {\n this._lock = 2;\n prevTime = rewinding ? dur : -0.0001;\n this.render(prevTime, true);\n this.vars.repeatRefresh && !isYoyo && this.invalidate();\n }\n\n this._lock = 0;\n\n if (!this._ts && !prevPaused) {\n return this;\n } //in order for yoyoEase to work properly when there's a stagger, we must swap out the ease in each sub-tween.\n\n\n _propagateYoyoEase(this, isYoyo);\n }\n }\n\n if (this._hasPause && !this._forcing && this._lock < 2) {\n pauseTween = _findNextPauseTween(this, _roundPrecise(prevTime), _roundPrecise(time));\n\n if (pauseTween) {\n tTime -= time - (time = pauseTween._start);\n }\n }\n\n this._tTime = tTime;\n this._time = time;\n this._act = !timeScale; //as long as it's not paused, force it to be active so that if the user renders independent of the parent timeline, it'll be forced to re-render on the next tick.\n\n if (!this._initted) {\n this._onUpdate = this.vars.onUpdate;\n this._initted = 1;\n this._zTime = totalTime;\n prevTime = 0; // upon init, the playhead should always go forward; someone could invalidate() a completed timeline and then if they restart(), that would make child tweens render in reverse order which could lock in the wrong starting values if they build on each other, like tl.to(obj, {x: 100}).to(obj, {x: 0}).\n }\n\n if (!prevTime && time && !suppressEvents && !iteration) {\n _callback(this, \"onStart\");\n\n if (this._tTime !== tTime) {\n // in case the onStart triggered a render at a different spot, eject. Like if someone did animation.pause(0.5) or something inside the onStart.\n return this;\n }\n }\n\n if (time >= prevTime && totalTime >= 0) {\n child = this._first;\n\n while (child) {\n next = child._next;\n\n if ((child._act || time >= child._start) && child._ts && pauseTween !== child) {\n if (child.parent !== this) {\n // an extreme edge case - the child's render could do something like kill() the \"next\" one in the linked list, or reparent it. In that case we must re-initiate the whole render to be safe.\n return this.render(totalTime, suppressEvents, force);\n }\n\n child.render(child._ts > 0 ? (time - child._start) * child._ts : (child._dirty ? child.totalDuration() : child._tDur) + (time - child._start) * child._ts, suppressEvents, force);\n\n if (time !== this._time || !this._ts && !prevPaused) {\n //in case a tween pauses or seeks the timeline when rendering, like inside of an onUpdate/onComplete\n pauseTween = 0;\n next && (tTime += this._zTime = -_tinyNum); // it didn't finish rendering, so flag zTime as negative so that so that the next time render() is called it'll be forced (to render any remaining children)\n\n break;\n }\n }\n\n child = next;\n }\n } else {\n child = this._last;\n var adjustedTime = totalTime < 0 ? totalTime : time; //when the playhead goes backward beyond the start of this timeline, we must pass that information down to the child animations so that zero-duration tweens know whether to render their starting or ending values.\n\n while (child) {\n next = child._prev;\n\n if ((child._act || adjustedTime <= child._end) && child._ts && pauseTween !== child) {\n if (child.parent !== this) {\n // an extreme edge case - the child's render could do something like kill() the \"next\" one in the linked list, or reparent it. In that case we must re-initiate the whole render to be safe.\n return this.render(totalTime, suppressEvents, force);\n }\n\n child.render(child._ts > 0 ? (adjustedTime - child._start) * child._ts : (child._dirty ? child.totalDuration() : child._tDur) + (adjustedTime - child._start) * child._ts, suppressEvents, force || _reverting && (child._initted || child._startAt)); // if reverting, we should always force renders of initted tweens (but remember that .fromTo() or .from() may have a _startAt but not _initted yet). If, for example, a .fromTo() tween with a stagger (which creates an internal timeline) gets reverted BEFORE some of its child tweens render for the first time, it may not properly trigger them to revert.\n\n if (time !== this._time || !this._ts && !prevPaused) {\n //in case a tween pauses or seeks the timeline when rendering, like inside of an onUpdate/onComplete\n pauseTween = 0;\n next && (tTime += this._zTime = adjustedTime ? -_tinyNum : _tinyNum); // it didn't finish rendering, so adjust zTime so that so that the next time render() is called it'll be forced (to render any remaining children)\n\n break;\n }\n }\n\n child = next;\n }\n }\n\n if (pauseTween && !suppressEvents) {\n this.pause();\n pauseTween.render(time >= prevTime ? 0 : -_tinyNum)._zTime = time >= prevTime ? 1 : -1;\n\n if (this._ts) {\n //the callback resumed playback! So since we may have held back the playhead due to where the pause is positioned, go ahead and jump to where it's SUPPOSED to be (if no pause happened).\n this._start = prevStart; //if the pause was at an earlier time and the user resumed in the callback, it could reposition the timeline (changing its startTime), throwing things off slightly, so we make sure the _start doesn't shift.\n\n _setEnd(this);\n\n return this.render(totalTime, suppressEvents, force);\n }\n }\n\n this._onUpdate && !suppressEvents && _callback(this, \"onUpdate\", true);\n if (tTime === tDur && this._tTime >= this.totalDuration() || !tTime && prevTime) if (prevStart === this._start || Math.abs(timeScale) !== Math.abs(this._ts)) if (!this._lock) {\n // remember, a child's callback may alter this timeline's playhead or timeScale which is why we need to add some of these checks.\n (totalTime || !dur) && (tTime === tDur && this._ts > 0 || !tTime && this._ts < 0) && _removeFromParent(this, 1); // don't remove if the timeline is reversed and the playhead isn't at 0, otherwise tl.progress(1).reverse() won't work. Only remove if the playhead is at the end and timeScale is positive, or if the playhead is at 0 and the timeScale is negative.\n\n if (!suppressEvents && !(totalTime < 0 && !prevTime) && (tTime || prevTime || !tDur)) {\n _callback(this, tTime === tDur && totalTime >= 0 ? \"onComplete\" : \"onReverseComplete\", true);\n\n this._prom && !(tTime < tDur && this.timeScale() > 0) && this._prom();\n }\n }\n }\n\n return this;\n };\n\n _proto2.add = function add(child, position) {\n var _this2 = this;\n\n _isNumber(position) || (position = _parsePosition(this, position, child));\n\n if (!(child instanceof Animation)) {\n if (_isArray(child)) {\n child.forEach(function (obj) {\n return _this2.add(obj, position);\n });\n return this;\n }\n\n if (_isString(child)) {\n return this.addLabel(child, position);\n }\n\n if (_isFunction(child)) {\n child = Tween.delayedCall(0, child);\n } else {\n return this;\n }\n }\n\n return this !== child ? _addToTimeline(this, child, position) : this; //don't allow a timeline to be added to itself as a child!\n };\n\n _proto2.getChildren = function getChildren(nested, tweens, timelines, ignoreBeforeTime) {\n if (nested === void 0) {\n nested = true;\n }\n\n if (tweens === void 0) {\n tweens = true;\n }\n\n if (timelines === void 0) {\n timelines = true;\n }\n\n if (ignoreBeforeTime === void 0) {\n ignoreBeforeTime = -_bigNum;\n }\n\n var a = [],\n child = this._first;\n\n while (child) {\n if (child._start >= ignoreBeforeTime) {\n if (child instanceof Tween) {\n tweens && a.push(child);\n } else {\n timelines && a.push(child);\n nested && a.push.apply(a, child.getChildren(true, tweens, timelines));\n }\n }\n\n child = child._next;\n }\n\n return a;\n };\n\n _proto2.getById = function getById(id) {\n var animations = this.getChildren(1, 1, 1),\n i = animations.length;\n\n while (i--) {\n if (animations[i].vars.id === id) {\n return animations[i];\n }\n }\n };\n\n _proto2.remove = function remove(child) {\n if (_isString(child)) {\n return this.removeLabel(child);\n }\n\n if (_isFunction(child)) {\n return this.killTweensOf(child);\n }\n\n _removeLinkedListItem(this, child);\n\n if (child === this._recent) {\n this._recent = this._last;\n }\n\n return _uncache(this);\n };\n\n _proto2.totalTime = function totalTime(_totalTime2, suppressEvents) {\n if (!arguments.length) {\n return this._tTime;\n }\n\n this._forcing = 1;\n\n if (!this._dp && this._ts) {\n //special case for the global timeline (or any other that has no parent or detached parent).\n this._start = _roundPrecise(_ticker.time - (this._ts > 0 ? _totalTime2 / this._ts : (this.totalDuration() - _totalTime2) / -this._ts));\n }\n\n _Animation.prototype.totalTime.call(this, _totalTime2, suppressEvents);\n\n this._forcing = 0;\n return this;\n };\n\n _proto2.addLabel = function addLabel(label, position) {\n this.labels[label] = _parsePosition(this, position);\n return this;\n };\n\n _proto2.removeLabel = function removeLabel(label) {\n delete this.labels[label];\n return this;\n };\n\n _proto2.addPause = function addPause(position, callback, params) {\n var t = Tween.delayedCall(0, callback || _emptyFunc, params);\n t.data = \"isPause\";\n this._hasPause = 1;\n return _addToTimeline(this, t, _parsePosition(this, position));\n };\n\n _proto2.removePause = function removePause(position) {\n var child = this._first;\n position = _parsePosition(this, position);\n\n while (child) {\n if (child._start === position && child.data === \"isPause\") {\n _removeFromParent(child);\n }\n\n child = child._next;\n }\n };\n\n _proto2.killTweensOf = function killTweensOf(targets, props, onlyActive) {\n var tweens = this.getTweensOf(targets, onlyActive),\n i = tweens.length;\n\n while (i--) {\n _overwritingTween !== tweens[i] && tweens[i].kill(targets, props);\n }\n\n return this;\n };\n\n _proto2.getTweensOf = function getTweensOf(targets, onlyActive) {\n var a = [],\n parsedTargets = toArray(targets),\n child = this._first,\n isGlobalTime = _isNumber(onlyActive),\n // a number is interpreted as a global time. If the animation spans\n children;\n\n while (child) {\n if (child instanceof Tween) {\n if (_arrayContainsAny(child._targets, parsedTargets) && (isGlobalTime ? (!_overwritingTween || child._initted && child._ts) && child.globalTime(0) <= onlyActive && child.globalTime(child.totalDuration()) > onlyActive : !onlyActive || child.isActive())) {\n // note: if this is for overwriting, it should only be for tweens that aren't paused and are initted.\n a.push(child);\n }\n } else if ((children = child.getTweensOf(parsedTargets, onlyActive)).length) {\n a.push.apply(a, children);\n }\n\n child = child._next;\n }\n\n return a;\n } // potential future feature - targets() on timelines\n // targets() {\n // \tlet result = [];\n // \tthis.getChildren(true, true, false).forEach(t => result.push(...t.targets()));\n // \treturn result.filter((v, i) => result.indexOf(v) === i);\n // }\n ;\n\n _proto2.tweenTo = function tweenTo(position, vars) {\n vars = vars || {};\n\n var tl = this,\n endTime = _parsePosition(tl, position),\n _vars = vars,\n startAt = _vars.startAt,\n _onStart = _vars.onStart,\n onStartParams = _vars.onStartParams,\n immediateRender = _vars.immediateRender,\n initted,\n tween = Tween.to(tl, _setDefaults({\n ease: vars.ease || \"none\",\n lazy: false,\n immediateRender: false,\n time: endTime,\n overwrite: \"auto\",\n duration: vars.duration || Math.abs((endTime - (startAt && \"time\" in startAt ? startAt.time : tl._time)) / tl.timeScale()) || _tinyNum,\n onStart: function onStart() {\n tl.pause();\n\n if (!initted) {\n var duration = vars.duration || Math.abs((endTime - (startAt && \"time\" in startAt ? startAt.time : tl._time)) / tl.timeScale());\n tween._dur !== duration && _setDuration(tween, duration, 0, 1).render(tween._time, true, true);\n initted = 1;\n }\n\n _onStart && _onStart.apply(tween, onStartParams || []); //in case the user had an onStart in the vars - we don't want to overwrite it.\n }\n }, vars));\n\n return immediateRender ? tween.render(0) : tween;\n };\n\n _proto2.tweenFromTo = function tweenFromTo(fromPosition, toPosition, vars) {\n return this.tweenTo(toPosition, _setDefaults({\n startAt: {\n time: _parsePosition(this, fromPosition)\n }\n }, vars));\n };\n\n _proto2.recent = function recent() {\n return this._recent;\n };\n\n _proto2.nextLabel = function nextLabel(afterTime) {\n if (afterTime === void 0) {\n afterTime = this._time;\n }\n\n return _getLabelInDirection(this, _parsePosition(this, afterTime));\n };\n\n _proto2.previousLabel = function previousLabel(beforeTime) {\n if (beforeTime === void 0) {\n beforeTime = this._time;\n }\n\n return _getLabelInDirection(this, _parsePosition(this, beforeTime), 1);\n };\n\n _proto2.currentLabel = function currentLabel(value) {\n return arguments.length ? this.seek(value, true) : this.previousLabel(this._time + _tinyNum);\n };\n\n _proto2.shiftChildren = function shiftChildren(amount, adjustLabels, ignoreBeforeTime) {\n if (ignoreBeforeTime === void 0) {\n ignoreBeforeTime = 0;\n }\n\n var child = this._first,\n labels = this.labels,\n p;\n\n while (child) {\n if (child._start >= ignoreBeforeTime) {\n child._start += amount;\n child._end += amount;\n }\n\n child = child._next;\n }\n\n if (adjustLabels) {\n for (p in labels) {\n if (labels[p] >= ignoreBeforeTime) {\n labels[p] += amount;\n }\n }\n }\n\n return _uncache(this);\n };\n\n _proto2.invalidate = function invalidate(soft) {\n var child = this._first;\n this._lock = 0;\n\n while (child) {\n child.invalidate(soft);\n child = child._next;\n }\n\n return _Animation.prototype.invalidate.call(this, soft);\n };\n\n _proto2.clear = function clear(includeLabels) {\n if (includeLabels === void 0) {\n includeLabels = true;\n }\n\n var child = this._first,\n next;\n\n while (child) {\n next = child._next;\n this.remove(child);\n child = next;\n }\n\n this._dp && (this._time = this._tTime = this._pTime = 0);\n includeLabels && (this.labels = {});\n return _uncache(this);\n };\n\n _proto2.totalDuration = function totalDuration(value) {\n var max = 0,\n self = this,\n child = self._last,\n prevStart = _bigNum,\n prev,\n start,\n parent;\n\n if (arguments.length) {\n return self.timeScale((self._repeat < 0 ? self.duration() : self.totalDuration()) / (self.reversed() ? -value : value));\n }\n\n if (self._dirty) {\n parent = self.parent;\n\n while (child) {\n prev = child._prev; //record it here in case the tween changes position in the sequence...\n\n child._dirty && child.totalDuration(); //could change the tween._startTime, so make sure the animation's cache is clean before analyzing it.\n\n start = child._start;\n\n if (start > prevStart && self._sort && child._ts && !self._lock) {\n //in case one of the tweens shifted out of order, it needs to be re-inserted into the correct position in the sequence\n self._lock = 1; //prevent endless recursive calls - there are methods that get triggered that check duration/totalDuration when we add().\n\n _addToTimeline(self, child, start - child._delay, 1)._lock = 0;\n } else {\n prevStart = start;\n }\n\n if (start < 0 && child._ts) {\n //children aren't allowed to have negative startTimes unless smoothChildTiming is true, so adjust here if one is found.\n max -= start;\n\n if (!parent && !self._dp || parent && parent.smoothChildTiming) {\n self._start += start / self._ts;\n self._time -= start;\n self._tTime -= start;\n }\n\n self.shiftChildren(-start, false, -1e999);\n prevStart = 0;\n }\n\n child._end > max && child._ts && (max = child._end);\n child = prev;\n }\n\n _setDuration(self, self === _globalTimeline && self._time > max ? self._time : max, 1, 1);\n\n self._dirty = 0;\n }\n\n return self._tDur;\n };\n\n Timeline.updateRoot = function updateRoot(time) {\n if (_globalTimeline._ts) {\n _lazySafeRender(_globalTimeline, _parentToChildTotalTime(time, _globalTimeline));\n\n _lastRenderedFrame = _ticker.frame;\n }\n\n if (_ticker.frame >= _nextGCFrame) {\n _nextGCFrame += _config.autoSleep || 120;\n var child = _globalTimeline._first;\n if (!child || !child._ts) if (_config.autoSleep && _ticker._listeners.length < 2) {\n while (child && !child._ts) {\n child = child._next;\n }\n\n child || _ticker.sleep();\n }\n }\n };\n\n return Timeline;\n}(Animation);\n\n_setDefaults(Timeline.prototype, {\n _lock: 0,\n _hasPause: 0,\n _forcing: 0\n});\n\nvar _addComplexStringPropTween = function _addComplexStringPropTween(target, prop, start, end, setter, stringFilter, funcParam) {\n //note: we call _addComplexStringPropTween.call(tweenInstance...) to ensure that it's scoped properly. We may call it from within a plugin too, thus \"this\" would refer to the plugin.\n var pt = new PropTween(this._pt, target, prop, 0, 1, _renderComplexString, null, setter),\n index = 0,\n matchIndex = 0,\n result,\n startNums,\n color,\n endNum,\n chunk,\n startNum,\n hasRandom,\n a;\n pt.b = start;\n pt.e = end;\n start += \"\"; //ensure values are strings\n\n end += \"\";\n\n if (hasRandom = ~end.indexOf(\"random(\")) {\n end = _replaceRandom(end);\n }\n\n if (stringFilter) {\n a = [start, end];\n stringFilter(a, target, prop); //pass an array with the starting and ending values and let the filter do whatever it needs to the values.\n\n start = a[0];\n end = a[1];\n }\n\n startNums = start.match(_complexStringNumExp) || [];\n\n while (result = _complexStringNumExp.exec(end)) {\n endNum = result[0];\n chunk = end.substring(index, result.index);\n\n if (color) {\n color = (color + 1) % 5;\n } else if (chunk.substr(-5) === \"rgba(\") {\n color = 1;\n }\n\n if (endNum !== startNums[matchIndex++]) {\n startNum = parseFloat(startNums[matchIndex - 1]) || 0; //these nested PropTweens are handled in a special way - we'll never actually call a render or setter method on them. We'll just loop through them in the parent complex string PropTween's render method.\n\n pt._pt = {\n _next: pt._pt,\n p: chunk || matchIndex === 1 ? chunk : \",\",\n //note: SVG spec allows omission of comma/space when a negative sign is wedged between two numbers, like 2.5-5.3 instead of 2.5,-5.3 but when tweening, the negative value may switch to positive, so we insert the comma just in case.\n s: startNum,\n c: endNum.charAt(1) === \"=\" ? _parseRelative(startNum, endNum) - startNum : parseFloat(endNum) - startNum,\n m: color && color < 4 ? Math.round : 0\n };\n index = _complexStringNumExp.lastIndex;\n }\n }\n\n pt.c = index < end.length ? end.substring(index, end.length) : \"\"; //we use the \"c\" of the PropTween to store the final part of the string (after the last number)\n\n pt.fp = funcParam;\n\n if (_relExp.test(end) || hasRandom) {\n pt.e = 0; //if the end string contains relative values or dynamic random(...) values, delete the end it so that on the final render we don't actually set it to the string with += or -= characters (forces it to use the calculated value).\n }\n\n this._pt = pt; //start the linked list with this new PropTween. Remember, we call _addComplexStringPropTween.call(tweenInstance...) to ensure that it's scoped properly. We may call it from within a plugin too, thus \"this\" would refer to the plugin.\n\n return pt;\n},\n _addPropTween = function _addPropTween(target, prop, start, end, index, targets, modifier, stringFilter, funcParam, optional) {\n _isFunction(end) && (end = end(index || 0, target, targets));\n var currentValue = target[prop],\n parsedStart = start !== \"get\" ? start : !_isFunction(currentValue) ? currentValue : funcParam ? target[prop.indexOf(\"set\") || !_isFunction(target[\"get\" + prop.substr(3)]) ? prop : \"get\" + prop.substr(3)](funcParam) : target[prop](),\n setter = !_isFunction(currentValue) ? _setterPlain : funcParam ? _setterFuncWithParam : _setterFunc,\n pt;\n\n if (_isString(end)) {\n if (~end.indexOf(\"random(\")) {\n end = _replaceRandom(end);\n }\n\n if (end.charAt(1) === \"=\") {\n pt = _parseRelative(parsedStart, end) + (getUnit(parsedStart) || 0);\n\n if (pt || pt === 0) {\n // to avoid isNaN, like if someone passes in a value like \"!= whatever\"\n end = pt;\n }\n }\n }\n\n if (!optional || parsedStart !== end || _forceAllPropTweens) {\n if (!isNaN(parsedStart * end) && end !== \"\") {\n // fun fact: any number multiplied by \"\" is evaluated as the number 0!\n pt = new PropTween(this._pt, target, prop, +parsedStart || 0, end - (parsedStart || 0), typeof currentValue === \"boolean\" ? _renderBoolean : _renderPlain, 0, setter);\n funcParam && (pt.fp = funcParam);\n modifier && pt.modifier(modifier, this, target);\n return this._pt = pt;\n }\n\n !currentValue && !(prop in target) && _missingPlugin(prop, end);\n return _addComplexStringPropTween.call(this, target, prop, parsedStart, end, setter, stringFilter || _config.stringFilter, funcParam);\n }\n},\n //creates a copy of the vars object and processes any function-based values (putting the resulting values directly into the copy) as well as strings with \"random()\" in them. It does NOT process relative values.\n_processVars = function _processVars(vars, index, target, targets, tween) {\n _isFunction(vars) && (vars = _parseFuncOrString(vars, tween, index, target, targets));\n\n if (!_isObject(vars) || vars.style && vars.nodeType || _isArray(vars) || _isTypedArray(vars)) {\n return _isString(vars) ? _parseFuncOrString(vars, tween, index, target, targets) : vars;\n }\n\n var copy = {},\n p;\n\n for (p in vars) {\n copy[p] = _parseFuncOrString(vars[p], tween, index, target, targets);\n }\n\n return copy;\n},\n _checkPlugin = function _checkPlugin(property, vars, tween, index, target, targets) {\n var plugin, pt, ptLookup, i;\n\n if (_plugins[property] && (plugin = new _plugins[property]()).init(target, plugin.rawVars ? vars[property] : _processVars(vars[property], index, target, targets, tween), tween, index, targets) !== false) {\n tween._pt = pt = new PropTween(tween._pt, target, property, 0, 1, plugin.render, plugin, 0, plugin.priority);\n\n if (tween !== _quickTween) {\n ptLookup = tween._ptLookup[tween._targets.indexOf(target)]; //note: we can't use tween._ptLookup[index] because for staggered tweens, the index from the fullTargets array won't match what it is in each individual tween that spawns from the stagger.\n\n i = plugin._props.length;\n\n while (i--) {\n ptLookup[plugin._props[i]] = pt;\n }\n }\n }\n\n return plugin;\n},\n _overwritingTween,\n //store a reference temporarily so we can avoid overwriting itself.\n_forceAllPropTweens,\n _initTween = function _initTween(tween, time, tTime) {\n var vars = tween.vars,\n ease = vars.ease,\n startAt = vars.startAt,\n immediateRender = vars.immediateRender,\n lazy = vars.lazy,\n onUpdate = vars.onUpdate,\n runBackwards = vars.runBackwards,\n yoyoEase = vars.yoyoEase,\n keyframes = vars.keyframes,\n autoRevert = vars.autoRevert,\n dur = tween._dur,\n prevStartAt = tween._startAt,\n targets = tween._targets,\n parent = tween.parent,\n fullTargets = parent && parent.data === \"nested\" ? parent.vars.targets : targets,\n autoOverwrite = tween._overwrite === \"auto\" && !_suppressOverwrites,\n tl = tween.timeline,\n cleanVars,\n i,\n p,\n pt,\n target,\n hasPriority,\n gsData,\n harness,\n plugin,\n ptLookup,\n index,\n harnessVars,\n overwritten;\n tl && (!keyframes || !ease) && (ease = \"none\");\n tween._ease = _parseEase(ease, _defaults.ease);\n tween._yEase = yoyoEase ? _invertEase(_parseEase(yoyoEase === true ? ease : yoyoEase, _defaults.ease)) : 0;\n\n if (yoyoEase && tween._yoyo && !tween._repeat) {\n //there must have been a parent timeline with yoyo:true that is currently in its yoyo phase, so flip the eases.\n yoyoEase = tween._yEase;\n tween._yEase = tween._ease;\n tween._ease = yoyoEase;\n }\n\n tween._from = !tl && !!vars.runBackwards; //nested timelines should never run backwards - the backwards-ness is in the child tweens.\n\n if (!tl || keyframes && !vars.stagger) {\n //if there's an internal timeline, skip all the parsing because we passed that task down the chain.\n harness = targets[0] ? _getCache(targets[0]).harness : 0;\n harnessVars = harness && vars[harness.prop]; //someone may need to specify CSS-specific values AND non-CSS values, like if the element has an \"x\" property plus it's a standard DOM element. We allow people to distinguish by wrapping plugin-specific stuff in a css:{} object for example.\n\n cleanVars = _copyExcluding(vars, _reservedProps);\n\n if (prevStartAt) {\n prevStartAt._zTime < 0 && prevStartAt.progress(1); // in case it's a lazy startAt that hasn't rendered yet.\n\n time < 0 && runBackwards && immediateRender && !autoRevert ? prevStartAt.render(-1, true) : prevStartAt.revert(runBackwards && dur ? _revertConfigNoKill : _startAtRevertConfig); // if it's a \"startAt\" (not \"from()\" or runBackwards: true), we only need to do a shallow revert (keep transforms cached in CSSPlugin)\n // don't just _removeFromParent(prevStartAt.render(-1, true)) because that'll leave inline styles. We're creating a new _startAt for \"startAt\" tweens that re-capture things to ensure that if the pre-tween values changed since the tween was created, they're recorded.\n\n prevStartAt._lazy = 0;\n }\n\n if (startAt) {\n _removeFromParent(tween._startAt = Tween.set(targets, _setDefaults({\n data: \"isStart\",\n overwrite: false,\n parent: parent,\n immediateRender: true,\n lazy: !prevStartAt && _isNotFalse(lazy),\n startAt: null,\n delay: 0,\n onUpdate: onUpdate && function () {\n return _callback(tween, \"onUpdate\");\n },\n stagger: 0\n }, startAt))); //copy the properties/values into a new object to avoid collisions, like var to = {x:0}, from = {x:500}; timeline.fromTo(e, from, to).fromTo(e, to, from);\n\n\n tween._startAt._dp = 0; // don't allow it to get put back into root timeline! Like when revert() is called and totalTime() gets set.\n\n tween._startAt._sat = tween; // used in globalTime(). _sat stands for _startAtTween\n\n time < 0 && (_reverting || !immediateRender && !autoRevert) && tween._startAt.revert(_revertConfigNoKill); // rare edge case, like if a render is forced in the negative direction of a non-initted tween.\n\n if (immediateRender) {\n if (dur && time <= 0 && tTime <= 0) {\n // check tTime here because in the case of a yoyo tween whose playhead gets pushed to the end like tween.progress(1), we should allow it through so that the onComplete gets fired properly.\n time && (tween._zTime = time);\n return; //we skip initialization here so that overwriting doesn't occur until the tween actually begins. Otherwise, if you create several immediateRender:true tweens of the same target/properties to drop into a Timeline, the last one created would overwrite the first ones because they didn't get placed into the timeline yet before the first render occurs and kicks in overwriting.\n }\n }\n } else if (runBackwards && dur) {\n //from() tweens must be handled uniquely: their beginning values must be rendered but we don't want overwriting to occur yet (when time is still 0). Wait until the tween actually begins before doing all the routines like overwriting. At that time, we should render at the END of the tween to ensure that things initialize correctly (remember, from() tweens go backwards)\n if (!prevStartAt) {\n time && (immediateRender = false); //in rare cases (like if a from() tween runs and then is invalidate()-ed), immediateRender could be true but the initial forced-render gets skipped, so there's no need to force the render in this context when the _time is greater than 0\n\n p = _setDefaults({\n overwrite: false,\n data: \"isFromStart\",\n //we tag the tween with as \"isFromStart\" so that if [inside a plugin] we need to only do something at the very END of a tween, we have a way of identifying this tween as merely the one that's setting the beginning values for a \"from()\" tween. For example, clearProps in CSSPlugin should only get applied at the very END of a tween and without this tag, from(...{height:100, clearProps:\"height\", delay:1}) would wipe the height at the beginning of the tween and after 1 second, it'd kick back in.\n lazy: immediateRender && !prevStartAt && _isNotFalse(lazy),\n immediateRender: immediateRender,\n //zero-duration tweens render immediately by default, but if we're not specifically instructed to render this tween immediately, we should skip this and merely _init() to record the starting values (rendering them immediately would push them to completion which is wasteful in that case - we'd have to render(-1) immediately after)\n stagger: 0,\n parent: parent //ensures that nested tweens that had a stagger are handled properly, like gsap.from(\".class\", {y: gsap.utils.wrap([-100,100]), stagger: 0.5})\n\n }, cleanVars);\n harnessVars && (p[harness.prop] = harnessVars); // in case someone does something like .from(..., {css:{}})\n\n _removeFromParent(tween._startAt = Tween.set(targets, p));\n\n tween._startAt._dp = 0; // don't allow it to get put back into root timeline!\n\n tween._startAt._sat = tween; // used in globalTime()\n\n time < 0 && (_reverting ? tween._startAt.revert(_revertConfigNoKill) : tween._startAt.render(-1, true));\n tween._zTime = time;\n\n if (!immediateRender) {\n _initTween(tween._startAt, _tinyNum, _tinyNum); //ensures that the initial values are recorded\n\n } else if (!time) {\n return;\n }\n }\n }\n\n tween._pt = tween._ptCache = 0;\n lazy = dur && _isNotFalse(lazy) || lazy && !dur;\n\n for (i = 0; i < targets.length; i++) {\n target = targets[i];\n gsData = target._gsap || _harness(targets)[i]._gsap;\n tween._ptLookup[i] = ptLookup = {};\n _lazyLookup[gsData.id] && _lazyTweens.length && _lazyRender(); //if other tweens of the same target have recently initted but haven't rendered yet, we've got to force the render so that the starting values are correct (imagine populating a timeline with a bunch of sequential tweens and then jumping to the end)\n\n index = fullTargets === targets ? i : fullTargets.indexOf(target);\n\n if (harness && (plugin = new harness()).init(target, harnessVars || cleanVars, tween, index, fullTargets) !== false) {\n tween._pt = pt = new PropTween(tween._pt, target, plugin.name, 0, 1, plugin.render, plugin, 0, plugin.priority);\n\n plugin._props.forEach(function (name) {\n ptLookup[name] = pt;\n });\n\n plugin.priority && (hasPriority = 1);\n }\n\n if (!harness || harnessVars) {\n for (p in cleanVars) {\n if (_plugins[p] && (plugin = _checkPlugin(p, cleanVars, tween, index, target, fullTargets))) {\n plugin.priority && (hasPriority = 1);\n } else {\n ptLookup[p] = pt = _addPropTween.call(tween, target, p, \"get\", cleanVars[p], index, fullTargets, 0, vars.stringFilter);\n }\n }\n }\n\n tween._op && tween._op[i] && tween.kill(target, tween._op[i]);\n\n if (autoOverwrite && tween._pt) {\n _overwritingTween = tween;\n\n _globalTimeline.killTweensOf(target, ptLookup, tween.globalTime(time)); // make sure the overwriting doesn't overwrite THIS tween!!!\n\n\n overwritten = !tween.parent;\n _overwritingTween = 0;\n }\n\n tween._pt && lazy && (_lazyLookup[gsData.id] = 1);\n }\n\n hasPriority && _sortPropTweensByPriority(tween);\n tween._onInit && tween._onInit(tween); //plugins like RoundProps must wait until ALL of the PropTweens are instantiated. In the plugin's init() function, it sets the _onInit on the tween instance. May not be pretty/intuitive, but it's fast and keeps file size down.\n }\n\n tween._onUpdate = onUpdate;\n tween._initted = (!tween._op || tween._pt) && !overwritten; // if overwrittenProps resulted in the entire tween being killed, do NOT flag it as initted or else it may render for one tick.\n\n keyframes && time <= 0 && tl.render(_bigNum, true, true); // if there's a 0% keyframe, it'll render in the \"before\" state for any staggered/delayed animations thus when the following tween initializes, it'll use the \"before\" state instead of the \"after\" state as the initial values.\n},\n _updatePropTweens = function _updatePropTweens(tween, property, value, start, startIsRelative, ratio, time, skipRecursion) {\n var ptCache = (tween._pt && tween._ptCache || (tween._ptCache = {}))[property],\n pt,\n rootPT,\n lookup,\n i;\n\n if (!ptCache) {\n ptCache = tween._ptCache[property] = [];\n lookup = tween._ptLookup;\n i = tween._targets.length;\n\n while (i--) {\n pt = lookup[i][property];\n\n if (pt && pt.d && pt.d._pt) {\n // it's a plugin, so find the nested PropTween\n pt = pt.d._pt;\n\n while (pt && pt.p !== property && pt.fp !== property) {\n // \"fp\" is functionParam for things like setting CSS variables which require .setProperty(\"--var-name\", value)\n pt = pt._next;\n }\n }\n\n if (!pt) {\n // there is no PropTween associated with that property, so we must FORCE one to be created and ditch out of this\n // if the tween has other properties that already rendered at new positions, we'd normally have to rewind to put them back like tween.render(0, true) before forcing an _initTween(), but that can create another edge case like tweening a timeline's progress would trigger onUpdates to fire which could move other things around. It's better to just inform users that .resetTo() should ONLY be used for tweens that already have that property. For example, you can't gsap.to(...{ y: 0 }) and then tween.restTo(\"x\", 200) for example.\n _forceAllPropTweens = 1; // otherwise, when we _addPropTween() and it finds no change between the start and end values, it skips creating a PropTween (for efficiency...why tween when there's no difference?) but in this case we NEED that PropTween created so we can edit it.\n\n tween.vars[property] = \"+=0\";\n\n _initTween(tween, time);\n\n _forceAllPropTweens = 0;\n return skipRecursion ? _warn(property + \" not eligible for reset\") : 1; // if someone tries to do a quickTo() on a special property like borderRadius which must get split into 4 different properties, that's not eligible for .resetTo().\n }\n\n ptCache.push(pt);\n }\n }\n\n i = ptCache.length;\n\n while (i--) {\n rootPT = ptCache[i];\n pt = rootPT._pt || rootPT; // complex values may have nested PropTweens. We only accommodate the FIRST value.\n\n pt.s = (start || start === 0) && !startIsRelative ? start : pt.s + (start || 0) + ratio * pt.c;\n pt.c = value - pt.s;\n rootPT.e && (rootPT.e = _round(value) + getUnit(rootPT.e)); // mainly for CSSPlugin (end value)\n\n rootPT.b && (rootPT.b = pt.s + getUnit(rootPT.b)); // (beginning value)\n }\n},\n _addAliasesToVars = function _addAliasesToVars(targets, vars) {\n var harness = targets[0] ? _getCache(targets[0]).harness : 0,\n propertyAliases = harness && harness.aliases,\n copy,\n p,\n i,\n aliases;\n\n if (!propertyAliases) {\n return vars;\n }\n\n copy = _merge({}, vars);\n\n for (p in propertyAliases) {\n if (p in copy) {\n aliases = propertyAliases[p].split(\",\");\n i = aliases.length;\n\n while (i--) {\n copy[aliases[i]] = copy[p];\n }\n }\n }\n\n return copy;\n},\n // parses multiple formats, like {\"0%\": {x: 100}, {\"50%\": {x: -20}} and { x: {\"0%\": 100, \"50%\": -20} }, and an \"ease\" can be set on any object. We populate an \"allProps\" object with an Array for each property, like {x: [{}, {}], y:[{}, {}]} with data for each property tween. The objects have a \"t\" (time), \"v\", (value), and \"e\" (ease) property. This allows us to piece together a timeline later.\n_parseKeyframe = function _parseKeyframe(prop, obj, allProps, easeEach) {\n var ease = obj.ease || easeEach || \"power1.inOut\",\n p,\n a;\n\n if (_isArray(obj)) {\n a = allProps[prop] || (allProps[prop] = []); // t = time (out of 100), v = value, e = ease\n\n obj.forEach(function (value, i) {\n return a.push({\n t: i / (obj.length - 1) * 100,\n v: value,\n e: ease\n });\n });\n } else {\n for (p in obj) {\n a = allProps[p] || (allProps[p] = []);\n p === \"ease\" || a.push({\n t: parseFloat(prop),\n v: obj[p],\n e: ease\n });\n }\n }\n},\n _parseFuncOrString = function _parseFuncOrString(value, tween, i, target, targets) {\n return _isFunction(value) ? value.call(tween, i, target, targets) : _isString(value) && ~value.indexOf(\"random(\") ? _replaceRandom(value) : value;\n},\n _staggerTweenProps = _callbackNames + \"repeat,repeatDelay,yoyo,repeatRefresh,yoyoEase,autoRevert\",\n _staggerPropsToSkip = {};\n\n_forEachName(_staggerTweenProps + \",id,stagger,delay,duration,paused,scrollTrigger\", function (name) {\n return _staggerPropsToSkip[name] = 1;\n});\n/*\n * --------------------------------------------------------------------------------------\n * TWEEN\n * --------------------------------------------------------------------------------------\n */\n\n\nexport var Tween = /*#__PURE__*/function (_Animation2) {\n _inheritsLoose(Tween, _Animation2);\n\n function Tween(targets, vars, position, skipInherit) {\n var _this3;\n\n if (typeof vars === \"number\") {\n position.duration = vars;\n vars = position;\n position = null;\n }\n\n _this3 = _Animation2.call(this, skipInherit ? vars : _inheritDefaults(vars)) || this;\n var _this3$vars = _this3.vars,\n duration = _this3$vars.duration,\n delay = _this3$vars.delay,\n immediateRender = _this3$vars.immediateRender,\n stagger = _this3$vars.stagger,\n overwrite = _this3$vars.overwrite,\n keyframes = _this3$vars.keyframes,\n defaults = _this3$vars.defaults,\n scrollTrigger = _this3$vars.scrollTrigger,\n yoyoEase = _this3$vars.yoyoEase,\n parent = vars.parent || _globalTimeline,\n parsedTargets = (_isArray(targets) || _isTypedArray(targets) ? _isNumber(targets[0]) : \"length\" in vars) ? [targets] : toArray(targets),\n tl,\n i,\n copy,\n l,\n p,\n curTarget,\n staggerFunc,\n staggerVarsToMerge;\n _this3._targets = parsedTargets.length ? _harness(parsedTargets) : _warn(\"GSAP target \" + targets + \" not found. https://gsap.com\", !_config.nullTargetWarn) || [];\n _this3._ptLookup = []; //PropTween lookup. An array containing an object for each target, having keys for each tweening property\n\n _this3._overwrite = overwrite;\n\n if (keyframes || stagger || _isFuncOrString(duration) || _isFuncOrString(delay)) {\n vars = _this3.vars;\n tl = _this3.timeline = new Timeline({\n data: \"nested\",\n defaults: defaults || {},\n targets: parent && parent.data === \"nested\" ? parent.vars.targets : parsedTargets\n }); // we need to store the targets because for staggers and keyframes, we end up creating an individual tween for each but function-based values need to know the index and the whole Array of targets.\n\n tl.kill();\n tl.parent = tl._dp = _assertThisInitialized(_this3);\n tl._start = 0;\n\n if (stagger || _isFuncOrString(duration) || _isFuncOrString(delay)) {\n l = parsedTargets.length;\n staggerFunc = stagger && distribute(stagger);\n\n if (_isObject(stagger)) {\n //users can pass in callbacks like onStart/onComplete in the stagger object. These should fire with each individual tween.\n for (p in stagger) {\n if (~_staggerTweenProps.indexOf(p)) {\n staggerVarsToMerge || (staggerVarsToMerge = {});\n staggerVarsToMerge[p] = stagger[p];\n }\n }\n }\n\n for (i = 0; i < l; i++) {\n copy = _copyExcluding(vars, _staggerPropsToSkip);\n copy.stagger = 0;\n yoyoEase && (copy.yoyoEase = yoyoEase);\n staggerVarsToMerge && _merge(copy, staggerVarsToMerge);\n curTarget = parsedTargets[i]; //don't just copy duration or delay because if they're a string or function, we'd end up in an infinite loop because _isFuncOrString() would evaluate as true in the child tweens, entering this loop, etc. So we parse the value straight from vars and default to 0.\n\n copy.duration = +_parseFuncOrString(duration, _assertThisInitialized(_this3), i, curTarget, parsedTargets);\n copy.delay = (+_parseFuncOrString(delay, _assertThisInitialized(_this3), i, curTarget, parsedTargets) || 0) - _this3._delay;\n\n if (!stagger && l === 1 && copy.delay) {\n // if someone does delay:\"random(1, 5)\", repeat:-1, for example, the delay shouldn't be inside the repeat.\n _this3._delay = delay = copy.delay;\n _this3._start += delay;\n copy.delay = 0;\n }\n\n tl.to(curTarget, copy, staggerFunc ? staggerFunc(i, curTarget, parsedTargets) : 0);\n tl._ease = _easeMap.none;\n }\n\n tl.duration() ? duration = delay = 0 : _this3.timeline = 0; // if the timeline's duration is 0, we don't need a timeline internally!\n } else if (keyframes) {\n _inheritDefaults(_setDefaults(tl.vars.defaults, {\n ease: \"none\"\n }));\n\n tl._ease = _parseEase(keyframes.ease || vars.ease || \"none\");\n var time = 0,\n a,\n kf,\n v;\n\n if (_isArray(keyframes)) {\n keyframes.forEach(function (frame) {\n return tl.to(parsedTargets, frame, \">\");\n });\n tl.duration(); // to ensure tl._dur is cached because we tap into it for performance purposes in the render() method.\n } else {\n copy = {};\n\n for (p in keyframes) {\n p === \"ease\" || p === \"easeEach\" || _parseKeyframe(p, keyframes[p], copy, keyframes.easeEach);\n }\n\n for (p in copy) {\n a = copy[p].sort(function (a, b) {\n return a.t - b.t;\n });\n time = 0;\n\n for (i = 0; i < a.length; i++) {\n kf = a[i];\n v = {\n ease: kf.e,\n duration: (kf.t - (i ? a[i - 1].t : 0)) / 100 * duration\n };\n v[p] = kf.v;\n tl.to(parsedTargets, v, time);\n time += v.duration;\n }\n }\n\n tl.duration() < duration && tl.to({}, {\n duration: duration - tl.duration()\n }); // in case keyframes didn't go to 100%\n }\n }\n\n duration || _this3.duration(duration = tl.duration());\n } else {\n _this3.timeline = 0; //speed optimization, faster lookups (no going up the prototype chain)\n }\n\n if (overwrite === true && !_suppressOverwrites) {\n _overwritingTween = _assertThisInitialized(_this3);\n\n _globalTimeline.killTweensOf(parsedTargets);\n\n _overwritingTween = 0;\n }\n\n _addToTimeline(parent, _assertThisInitialized(_this3), position);\n\n vars.reversed && _this3.reverse();\n vars.paused && _this3.paused(true);\n\n if (immediateRender || !duration && !keyframes && _this3._start === _roundPrecise(parent._time) && _isNotFalse(immediateRender) && _hasNoPausedAncestors(_assertThisInitialized(_this3)) && parent.data !== \"nested\") {\n _this3._tTime = -_tinyNum; //forces a render without having to set the render() \"force\" parameter to true because we want to allow lazying by default (using the \"force\" parameter always forces an immediate full render)\n\n _this3.render(Math.max(0, -delay) || 0); //in case delay is negative\n\n }\n\n scrollTrigger && _scrollTrigger(_assertThisInitialized(_this3), scrollTrigger);\n return _this3;\n }\n\n var _proto3 = Tween.prototype;\n\n _proto3.render = function render(totalTime, suppressEvents, force) {\n var prevTime = this._time,\n tDur = this._tDur,\n dur = this._dur,\n isNegative = totalTime < 0,\n tTime = totalTime > tDur - _tinyNum && !isNegative ? tDur : totalTime < _tinyNum ? 0 : totalTime,\n time,\n pt,\n iteration,\n cycleDuration,\n prevIteration,\n isYoyo,\n ratio,\n timeline,\n yoyoEase;\n\n if (!dur) {\n _renderZeroDurationTween(this, totalTime, suppressEvents, force);\n } else if (tTime !== this._tTime || !totalTime || force || !this._initted && this._tTime || this._startAt && this._zTime < 0 !== isNegative) {\n //this senses if we're crossing over the start time, in which case we must record _zTime and force the render, but we do it in this lengthy conditional way for performance reasons (usually we can skip the calculations): this._initted && (this._zTime < 0) !== (totalTime < 0)\n time = tTime;\n timeline = this.timeline;\n\n if (this._repeat) {\n //adjust the time for repeats and yoyos\n cycleDuration = dur + this._rDelay;\n\n if (this._repeat < -1 && isNegative) {\n return this.totalTime(cycleDuration * 100 + totalTime, suppressEvents, force);\n }\n\n time = _roundPrecise(tTime % cycleDuration); //round to avoid floating point errors. (4 % 0.8 should be 0 but some browsers report it as 0.79999999!)\n\n if (tTime === tDur) {\n // the tDur === tTime is for edge cases where there's a lengthy decimal on the duration and it may reach the very end but the time is rendered as not-quite-there (remember, tDur is rounded to 4 decimals whereas dur isn't)\n iteration = this._repeat;\n time = dur;\n } else {\n iteration = ~~(tTime / cycleDuration);\n\n if (iteration && iteration === _roundPrecise(tTime / cycleDuration)) {\n time = dur;\n iteration--;\n }\n\n time > dur && (time = dur);\n }\n\n isYoyo = this._yoyo && iteration & 1;\n\n if (isYoyo) {\n yoyoEase = this._yEase;\n time = dur - time;\n }\n\n prevIteration = _animationCycle(this._tTime, cycleDuration);\n\n if (time === prevTime && !force && this._initted && iteration === prevIteration) {\n //could be during the repeatDelay part. No need to render and fire callbacks.\n this._tTime = tTime;\n return this;\n }\n\n if (iteration !== prevIteration) {\n timeline && this._yEase && _propagateYoyoEase(timeline, isYoyo); //repeatRefresh functionality\n\n if (this.vars.repeatRefresh && !isYoyo && !this._lock && this._time !== cycleDuration && this._initted) {\n // this._time will === cycleDuration when we render at EXACTLY the end of an iteration. Without this condition, it'd often do the repeatRefresh render TWICE (again on the very next tick).\n this._lock = force = 1; //force, otherwise if lazy is true, the _attemptInitTween() will return and we'll jump out and get caught bouncing on each tick.\n\n this.render(_roundPrecise(cycleDuration * iteration), true).invalidate()._lock = 0;\n }\n }\n }\n\n if (!this._initted) {\n if (_attemptInitTween(this, isNegative ? totalTime : time, force, suppressEvents, tTime)) {\n this._tTime = 0; // in constructor if immediateRender is true, we set _tTime to -_tinyNum to have the playhead cross the starting point but we can't leave _tTime as a negative number.\n\n return this;\n }\n\n if (prevTime !== this._time && !(force && this.vars.repeatRefresh && iteration !== prevIteration)) {\n // rare edge case - during initialization, an onUpdate in the _startAt (.fromTo()) might force this tween to render at a different spot in which case we should ditch this render() call so that it doesn't revert the values. But we also don't want to dump if we're doing a repeatRefresh render!\n return this;\n }\n\n if (dur !== this._dur) {\n // while initting, a plugin like InertiaPlugin might alter the duration, so rerun from the start to ensure everything renders as it should.\n return this.render(totalTime, suppressEvents, force);\n }\n }\n\n this._tTime = tTime;\n this._time = time;\n\n if (!this._act && this._ts) {\n this._act = 1; //as long as it's not paused, force it to be active so that if the user renders independent of the parent timeline, it'll be forced to re-render on the next tick.\n\n this._lazy = 0;\n }\n\n this.ratio = ratio = (yoyoEase || this._ease)(time / dur);\n\n if (this._from) {\n this.ratio = ratio = 1 - ratio;\n }\n\n if (time && !prevTime && !suppressEvents && !iteration) {\n _callback(this, \"onStart\");\n\n if (this._tTime !== tTime) {\n // in case the onStart triggered a render at a different spot, eject. Like if someone did animation.pause(0.5) or something inside the onStart.\n return this;\n }\n }\n\n pt = this._pt;\n\n while (pt) {\n pt.r(ratio, pt.d);\n pt = pt._next;\n }\n\n timeline && timeline.render(totalTime < 0 ? totalTime : timeline._dur * timeline._ease(time / this._dur), suppressEvents, force) || this._startAt && (this._zTime = totalTime);\n\n if (this._onUpdate && !suppressEvents) {\n isNegative && _rewindStartAt(this, totalTime, suppressEvents, force); //note: for performance reasons, we tuck this conditional logic inside less traveled areas (most tweens don't have an onUpdate). We'd just have it at the end before the onComplete, but the values should be updated before any onUpdate is called, so we ALSO put it here and then if it's not called, we do so later near the onComplete.\n\n _callback(this, \"onUpdate\");\n }\n\n this._repeat && iteration !== prevIteration && this.vars.onRepeat && !suppressEvents && this.parent && _callback(this, \"onRepeat\");\n\n if ((tTime === this._tDur || !tTime) && this._tTime === tTime) {\n isNegative && !this._onUpdate && _rewindStartAt(this, totalTime, true, true);\n (totalTime || !dur) && (tTime === this._tDur && this._ts > 0 || !tTime && this._ts < 0) && _removeFromParent(this, 1); // don't remove if we're rendering at exactly a time of 0, as there could be autoRevert values that should get set on the next tick (if the playhead goes backward beyond the startTime, negative totalTime). Don't remove if the timeline is reversed and the playhead isn't at 0, otherwise tl.progress(1).reverse() won't work. Only remove if the playhead is at the end and timeScale is positive, or if the playhead is at 0 and the timeScale is negative.\n\n if (!suppressEvents && !(isNegative && !prevTime) && (tTime || prevTime || isYoyo)) {\n // if prevTime and tTime are zero, we shouldn't fire the onReverseComplete. This could happen if you gsap.to(... {paused:true}).play();\n _callback(this, tTime === tDur ? \"onComplete\" : \"onReverseComplete\", true);\n\n this._prom && !(tTime < tDur && this.timeScale() > 0) && this._prom();\n }\n }\n }\n\n return this;\n };\n\n _proto3.targets = function targets() {\n return this._targets;\n };\n\n _proto3.invalidate = function invalidate(soft) {\n // \"soft\" gives us a way to clear out everything EXCEPT the recorded pre-\"from\" portion of from() tweens. Otherwise, for example, if you tween.progress(1).render(0, true true).invalidate(), the \"from\" values would persist and then on the next render, the from() tweens would initialize and the current value would match the \"from\" values, thus animate from the same value to the same value (no animation). We tap into this in ScrollTrigger's refresh() where we must push a tween to completion and then back again but honor its init state in case the tween is dependent on another tween further up on the page.\n (!soft || !this.vars.runBackwards) && (this._startAt = 0);\n this._pt = this._op = this._onUpdate = this._lazy = this.ratio = 0;\n this._ptLookup = [];\n this.timeline && this.timeline.invalidate(soft);\n return _Animation2.prototype.invalidate.call(this, soft);\n };\n\n _proto3.resetTo = function resetTo(property, value, start, startIsRelative, skipRecursion) {\n _tickerActive || _ticker.wake();\n this._ts || this.play();\n var time = Math.min(this._dur, (this._dp._time - this._start) * this._ts),\n ratio;\n this._initted || _initTween(this, time);\n ratio = this._ease(time / this._dur); // don't just get tween.ratio because it may not have rendered yet.\n // possible future addition to allow an object with multiple values to update, like tween.resetTo({x: 100, y: 200}); At this point, it doesn't seem worth the added kb given the fact that most users will likely opt for the convenient gsap.quickTo() way of interacting with this method.\n // if (_isObject(property)) { // performance optimization\n // \tfor (p in property) {\n // \t\tif (_updatePropTweens(this, p, property[p], value ? value[p] : null, start, ratio, time)) {\n // \t\t\treturn this.resetTo(property, value, start, startIsRelative); // if a PropTween wasn't found for the property, it'll get forced with a re-initialization so we need to jump out and start over again.\n // \t\t}\n // \t}\n // } else {\n\n if (_updatePropTweens(this, property, value, start, startIsRelative, ratio, time, skipRecursion)) {\n return this.resetTo(property, value, start, startIsRelative, 1); // if a PropTween wasn't found for the property, it'll get forced with a re-initialization so we need to jump out and start over again.\n } //}\n\n\n _alignPlayhead(this, 0);\n\n this.parent || _addLinkedListItem(this._dp, this, \"_first\", \"_last\", this._dp._sort ? \"_start\" : 0);\n return this.render(0);\n };\n\n _proto3.kill = function kill(targets, vars) {\n if (vars === void 0) {\n vars = \"all\";\n }\n\n if (!targets && (!vars || vars === \"all\")) {\n this._lazy = this._pt = 0;\n return this.parent ? _interrupt(this) : this;\n }\n\n if (this.timeline) {\n var tDur = this.timeline.totalDuration();\n this.timeline.killTweensOf(targets, vars, _overwritingTween && _overwritingTween.vars.overwrite !== true)._first || _interrupt(this); // if nothing is left tweening, interrupt.\n\n this.parent && tDur !== this.timeline.totalDuration() && _setDuration(this, this._dur * this.timeline._tDur / tDur, 0, 1); // if a nested tween is killed that changes the duration, it should affect this tween's duration. We must use the ratio, though, because sometimes the internal timeline is stretched like for keyframes where they don't all add up to whatever the parent tween's duration was set to.\n\n return this;\n }\n\n var parsedTargets = this._targets,\n killingTargets = targets ? toArray(targets) : parsedTargets,\n propTweenLookup = this._ptLookup,\n firstPT = this._pt,\n overwrittenProps,\n curLookup,\n curOverwriteProps,\n props,\n p,\n pt,\n i;\n\n if ((!vars || vars === \"all\") && _arraysMatch(parsedTargets, killingTargets)) {\n vars === \"all\" && (this._pt = 0);\n return _interrupt(this);\n }\n\n overwrittenProps = this._op = this._op || [];\n\n if (vars !== \"all\") {\n //so people can pass in a comma-delimited list of property names\n if (_isString(vars)) {\n p = {};\n\n _forEachName(vars, function (name) {\n return p[name] = 1;\n });\n\n vars = p;\n }\n\n vars = _addAliasesToVars(parsedTargets, vars);\n }\n\n i = parsedTargets.length;\n\n while (i--) {\n if (~killingTargets.indexOf(parsedTargets[i])) {\n curLookup = propTweenLookup[i];\n\n if (vars === \"all\") {\n overwrittenProps[i] = vars;\n props = curLookup;\n curOverwriteProps = {};\n } else {\n curOverwriteProps = overwrittenProps[i] = overwrittenProps[i] || {};\n props = vars;\n }\n\n for (p in props) {\n pt = curLookup && curLookup[p];\n\n if (pt) {\n if (!(\"kill\" in pt.d) || pt.d.kill(p) === true) {\n _removeLinkedListItem(this, pt, \"_pt\");\n }\n\n delete curLookup[p];\n }\n\n if (curOverwriteProps !== \"all\") {\n curOverwriteProps[p] = 1;\n }\n }\n }\n }\n\n this._initted && !this._pt && firstPT && _interrupt(this); //if all tweening properties are killed, kill the tween. Without this line, if there's a tween with multiple targets and then you killTweensOf() each target individually, the tween would technically still remain active and fire its onComplete even though there aren't any more properties tweening.\n\n return this;\n };\n\n Tween.to = function to(targets, vars) {\n return new Tween(targets, vars, arguments[2]);\n };\n\n Tween.from = function from(targets, vars) {\n return _createTweenType(1, arguments);\n };\n\n Tween.delayedCall = function delayedCall(delay, callback, params, scope) {\n return new Tween(callback, 0, {\n immediateRender: false,\n lazy: false,\n overwrite: false,\n delay: delay,\n onComplete: callback,\n onReverseComplete: callback,\n onCompleteParams: params,\n onReverseCompleteParams: params,\n callbackScope: scope\n }); // we must use onReverseComplete too for things like timeline.add(() => {...}) which should be triggered in BOTH directions (forward and reverse)\n };\n\n Tween.fromTo = function fromTo(targets, fromVars, toVars) {\n return _createTweenType(2, arguments);\n };\n\n Tween.set = function set(targets, vars) {\n vars.duration = 0;\n vars.repeatDelay || (vars.repeat = 0);\n return new Tween(targets, vars);\n };\n\n Tween.killTweensOf = function killTweensOf(targets, props, onlyActive) {\n return _globalTimeline.killTweensOf(targets, props, onlyActive);\n };\n\n return Tween;\n}(Animation);\n\n_setDefaults(Tween.prototype, {\n _targets: [],\n _lazy: 0,\n _startAt: 0,\n _op: 0,\n _onInit: 0\n}); //add the pertinent timeline methods to Tween instances so that users can chain conveniently and create a timeline automatically. (removed due to concerns that it'd ultimately add to more confusion especially for beginners)\n// _forEachName(\"to,from,fromTo,set,call,add,addLabel,addPause\", name => {\n// \tTween.prototype[name] = function() {\n// \t\tlet tl = new Timeline();\n// \t\treturn _addToTimeline(tl, this)[name].apply(tl, toArray(arguments));\n// \t}\n// });\n//for backward compatibility. Leverage the timeline calls.\n\n\n_forEachName(\"staggerTo,staggerFrom,staggerFromTo\", function (name) {\n Tween[name] = function () {\n var tl = new Timeline(),\n params = _slice.call(arguments, 0);\n\n params.splice(name === \"staggerFromTo\" ? 5 : 4, 0, 0);\n return tl[name].apply(tl, params);\n };\n});\n/*\n * --------------------------------------------------------------------------------------\n * PROPTWEEN\n * --------------------------------------------------------------------------------------\n */\n\n\nvar _setterPlain = function _setterPlain(target, property, value) {\n return target[property] = value;\n},\n _setterFunc = function _setterFunc(target, property, value) {\n return target[property](value);\n},\n _setterFuncWithParam = function _setterFuncWithParam(target, property, value, data) {\n return target[property](data.fp, value);\n},\n _setterAttribute = function _setterAttribute(target, property, value) {\n return target.setAttribute(property, value);\n},\n _getSetter = function _getSetter(target, property) {\n return _isFunction(target[property]) ? _setterFunc : _isUndefined(target[property]) && target.setAttribute ? _setterAttribute : _setterPlain;\n},\n _renderPlain = function _renderPlain(ratio, data) {\n return data.set(data.t, data.p, Math.round((data.s + data.c * ratio) * 1000000) / 1000000, data);\n},\n _renderBoolean = function _renderBoolean(ratio, data) {\n return data.set(data.t, data.p, !!(data.s + data.c * ratio), data);\n},\n _renderComplexString = function _renderComplexString(ratio, data) {\n var pt = data._pt,\n s = \"\";\n\n if (!ratio && data.b) {\n //b = beginning string\n s = data.b;\n } else if (ratio === 1 && data.e) {\n //e = ending string\n s = data.e;\n } else {\n while (pt) {\n s = pt.p + (pt.m ? pt.m(pt.s + pt.c * ratio) : Math.round((pt.s + pt.c * ratio) * 10000) / 10000) + s; //we use the \"p\" property for the text inbetween (like a suffix). And in the context of a complex string, the modifier (m) is typically just Math.round(), like for RGB colors.\n\n pt = pt._next;\n }\n\n s += data.c; //we use the \"c\" of the PropTween to store the final chunk of non-numeric text.\n }\n\n data.set(data.t, data.p, s, data);\n},\n _renderPropTweens = function _renderPropTweens(ratio, data) {\n var pt = data._pt;\n\n while (pt) {\n pt.r(ratio, pt.d);\n pt = pt._next;\n }\n},\n _addPluginModifier = function _addPluginModifier(modifier, tween, target, property) {\n var pt = this._pt,\n next;\n\n while (pt) {\n next = pt._next;\n pt.p === property && pt.modifier(modifier, tween, target);\n pt = next;\n }\n},\n _killPropTweensOf = function _killPropTweensOf(property) {\n var pt = this._pt,\n hasNonDependentRemaining,\n next;\n\n while (pt) {\n next = pt._next;\n\n if (pt.p === property && !pt.op || pt.op === property) {\n _removeLinkedListItem(this, pt, \"_pt\");\n } else if (!pt.dep) {\n hasNonDependentRemaining = 1;\n }\n\n pt = next;\n }\n\n return !hasNonDependentRemaining;\n},\n _setterWithModifier = function _setterWithModifier(target, property, value, data) {\n data.mSet(target, property, data.m.call(data.tween, value, data.mt), data);\n},\n _sortPropTweensByPriority = function _sortPropTweensByPriority(parent) {\n var pt = parent._pt,\n next,\n pt2,\n first,\n last; //sorts the PropTween linked list in order of priority because some plugins need to do their work after ALL of the PropTweens were created (like RoundPropsPlugin and ModifiersPlugin)\n\n while (pt) {\n next = pt._next;\n pt2 = first;\n\n while (pt2 && pt2.pr > pt.pr) {\n pt2 = pt2._next;\n }\n\n if (pt._prev = pt2 ? pt2._prev : last) {\n pt._prev._next = pt;\n } else {\n first = pt;\n }\n\n if (pt._next = pt2) {\n pt2._prev = pt;\n } else {\n last = pt;\n }\n\n pt = next;\n }\n\n parent._pt = first;\n}; //PropTween key: t = target, p = prop, r = renderer, d = data, s = start, c = change, op = overwriteProperty (ONLY populated when it's different than p), pr = priority, _next/_prev for the linked list siblings, set = setter, m = modifier, mSet = modifierSetter (the original setter, before a modifier was added)\n\n\nexport var PropTween = /*#__PURE__*/function () {\n function PropTween(next, target, prop, start, change, renderer, data, setter, priority) {\n this.t = target;\n this.s = start;\n this.c = change;\n this.p = prop;\n this.r = renderer || _renderPlain;\n this.d = data || this;\n this.set = setter || _setterPlain;\n this.pr = priority || 0;\n this._next = next;\n\n if (next) {\n next._prev = this;\n }\n }\n\n var _proto4 = PropTween.prototype;\n\n _proto4.modifier = function modifier(func, tween, target) {\n this.mSet = this.mSet || this.set; //in case it was already set (a PropTween can only have one modifier)\n\n this.set = _setterWithModifier;\n this.m = func;\n this.mt = target; //modifier target\n\n this.tween = tween;\n };\n\n return PropTween;\n}(); //Initialization tasks\n\n_forEachName(_callbackNames + \"parent,duration,ease,delay,overwrite,runBackwards,startAt,yoyo,immediateRender,repeat,repeatDelay,data,paused,reversed,lazy,callbackScope,stringFilter,id,yoyoEase,stagger,inherit,repeatRefresh,keyframes,autoRevert,scrollTrigger\", function (name) {\n return _reservedProps[name] = 1;\n});\n\n_globals.TweenMax = _globals.TweenLite = Tween;\n_globals.TimelineLite = _globals.TimelineMax = Timeline;\n_globalTimeline = new Timeline({\n sortChildren: false,\n defaults: _defaults,\n autoRemoveChildren: true,\n id: \"root\",\n smoothChildTiming: true\n});\n_config.stringFilter = _colorStringFilter;\n\nvar _media = [],\n _listeners = {},\n _emptyArray = [],\n _lastMediaTime = 0,\n _contextID = 0,\n _dispatch = function _dispatch(type) {\n return (_listeners[type] || _emptyArray).map(function (f) {\n return f();\n });\n},\n _onMediaChange = function _onMediaChange() {\n var time = Date.now(),\n matches = [];\n\n if (time - _lastMediaTime > 2) {\n _dispatch(\"matchMediaInit\");\n\n _media.forEach(function (c) {\n var queries = c.queries,\n conditions = c.conditions,\n match,\n p,\n anyMatch,\n toggled;\n\n for (p in queries) {\n match = _win.matchMedia(queries[p]).matches; // Firefox doesn't update the \"matches\" property of the MediaQueryList object correctly - it only does so as it calls its change handler - so we must re-create a media query here to ensure it's accurate.\n\n match && (anyMatch = 1);\n\n if (match !== conditions[p]) {\n conditions[p] = match;\n toggled = 1;\n }\n }\n\n if (toggled) {\n c.revert();\n anyMatch && matches.push(c);\n }\n });\n\n _dispatch(\"matchMediaRevert\");\n\n matches.forEach(function (c) {\n return c.onMatch(c, function (func) {\n return c.add(null, func);\n });\n });\n _lastMediaTime = time;\n\n _dispatch(\"matchMedia\");\n }\n};\n\nvar Context = /*#__PURE__*/function () {\n function Context(func, scope) {\n this.selector = scope && selector(scope);\n this.data = [];\n this._r = []; // returned/cleanup functions\n\n this.isReverted = false;\n this.id = _contextID++; // to work around issues that frameworks like Vue cause by making things into Proxies which make it impossible to do something like _media.indexOf(this) because \"this\" would no longer refer to the Context instance itself - it'd refer to a Proxy! We needed a way to identify the context uniquely\n\n func && this.add(func);\n }\n\n var _proto5 = Context.prototype;\n\n _proto5.add = function add(name, func, scope) {\n // possible future addition if we need the ability to add() an animation to a context and for whatever reason cannot create that animation inside of a context.add(() => {...}) function.\n // if (name && _isFunction(name.revert)) {\n // \tthis.data.push(name);\n // \treturn (name._ctx = this);\n // }\n if (_isFunction(name)) {\n scope = func;\n func = name;\n name = _isFunction;\n }\n\n var self = this,\n f = function f() {\n var prev = _context,\n prevSelector = self.selector,\n result;\n prev && prev !== self && prev.data.push(self);\n scope && (self.selector = selector(scope));\n _context = self;\n result = func.apply(self, arguments);\n _isFunction(result) && self._r.push(result);\n _context = prev;\n self.selector = prevSelector;\n self.isReverted = false;\n return result;\n };\n\n self.last = f;\n return name === _isFunction ? f(self, function (func) {\n return self.add(null, func);\n }) : name ? self[name] = f : f;\n };\n\n _proto5.ignore = function ignore(func) {\n var prev = _context;\n _context = null;\n func(this);\n _context = prev;\n };\n\n _proto5.getTweens = function getTweens() {\n var a = [];\n this.data.forEach(function (e) {\n return e instanceof Context ? a.push.apply(a, e.getTweens()) : e instanceof Tween && !(e.parent && e.parent.data === \"nested\") && a.push(e);\n });\n return a;\n };\n\n _proto5.clear = function clear() {\n this._r.length = this.data.length = 0;\n };\n\n _proto5.kill = function kill(revert, matchMedia) {\n var _this4 = this;\n\n if (revert) {\n (function () {\n var tweens = _this4.getTweens(),\n i = _this4.data.length,\n t;\n\n while (i--) {\n // Flip plugin tweens are very different in that they should actually be pushed to their end. The plugin replaces the timeline's .revert() method to do exactly that. But we also need to remove any of those nested tweens inside the flip timeline so that they don't get individually reverted.\n t = _this4.data[i];\n\n if (t.data === \"isFlip\") {\n t.revert();\n t.getChildren(true, true, false).forEach(function (tween) {\n return tweens.splice(tweens.indexOf(tween), 1);\n });\n }\n } // save as an object so that we can cache the globalTime for each tween to optimize performance during the sort\n\n\n tweens.map(function (t) {\n return {\n g: t._dur || t._delay || t._sat && !t._sat.vars.immediateRender ? t.globalTime(0) : -Infinity,\n t: t\n };\n }).sort(function (a, b) {\n return b.g - a.g || -Infinity;\n }).forEach(function (o) {\n return o.t.revert(revert);\n }); // note: all of the _startAt tweens should be reverted in reverse order that they were created, and they'll all have the same globalTime (-1) so the \" || -1\" in the sort keeps the order properly.\n\n i = _this4.data.length;\n\n while (i--) {\n // make sure we loop backwards so that, for example, SplitTexts that were created later on the same element get reverted first\n t = _this4.data[i];\n\n if (t instanceof Timeline) {\n if (t.data !== \"nested\") {\n t.scrollTrigger && t.scrollTrigger.revert();\n t.kill(); // don't revert() the timeline because that's duplicating efforts since we already reverted all the tweens\n }\n } else {\n !(t instanceof Tween) && t.revert && t.revert(revert);\n }\n }\n\n _this4._r.forEach(function (f) {\n return f(revert, _this4);\n });\n\n _this4.isReverted = true;\n })();\n } else {\n this.data.forEach(function (e) {\n return e.kill && e.kill();\n });\n }\n\n this.clear();\n\n if (matchMedia) {\n var i = _media.length;\n\n while (i--) {\n // previously, we checked _media.indexOf(this), but some frameworks like Vue enforce Proxy objects that make it impossible to get the proper result that way, so we must use a unique ID number instead.\n _media[i].id === this.id && _media.splice(i, 1);\n }\n }\n };\n\n _proto5.revert = function revert(config) {\n this.kill(config || {});\n };\n\n return Context;\n}();\n\nvar MatchMedia = /*#__PURE__*/function () {\n function MatchMedia(scope) {\n this.contexts = [];\n this.scope = scope;\n _context && _context.data.push(this);\n }\n\n var _proto6 = MatchMedia.prototype;\n\n _proto6.add = function add(conditions, func, scope) {\n _isObject(conditions) || (conditions = {\n matches: conditions\n });\n var context = new Context(0, scope || this.scope),\n cond = context.conditions = {},\n mq,\n p,\n active;\n _context && !context.selector && (context.selector = _context.selector); // in case a context is created inside a context. Like a gsap.matchMedia() that's inside a scoped gsap.context()\n\n this.contexts.push(context);\n func = context.add(\"onMatch\", func);\n context.queries = conditions;\n\n for (p in conditions) {\n if (p === \"all\") {\n active = 1;\n } else {\n mq = _win.matchMedia(conditions[p]);\n\n if (mq) {\n _media.indexOf(context) < 0 && _media.push(context);\n (cond[p] = mq.matches) && (active = 1);\n mq.addListener ? mq.addListener(_onMediaChange) : mq.addEventListener(\"change\", _onMediaChange);\n }\n }\n }\n\n active && func(context, function (f) {\n return context.add(null, f);\n });\n return this;\n } // refresh() {\n // \tlet time = _lastMediaTime,\n // \t\tmedia = _media;\n // \t_lastMediaTime = -1;\n // \t_media = this.contexts;\n // \t_onMediaChange();\n // \t_lastMediaTime = time;\n // \t_media = media;\n // }\n ;\n\n _proto6.revert = function revert(config) {\n this.kill(config || {});\n };\n\n _proto6.kill = function kill(revert) {\n this.contexts.forEach(function (c) {\n return c.kill(revert, true);\n });\n };\n\n return MatchMedia;\n}();\n/*\n * --------------------------------------------------------------------------------------\n * GSAP\n * --------------------------------------------------------------------------------------\n */\n\n\nvar _gsap = {\n registerPlugin: function registerPlugin() {\n for (var _len2 = arguments.length, args = new Array(_len2), _key2 = 0; _key2 < _len2; _key2++) {\n args[_key2] = arguments[_key2];\n }\n\n args.forEach(function (config) {\n return _createPlugin(config);\n });\n },\n timeline: function timeline(vars) {\n return new Timeline(vars);\n },\n getTweensOf: function getTweensOf(targets, onlyActive) {\n return _globalTimeline.getTweensOf(targets, onlyActive);\n },\n getProperty: function getProperty(target, property, unit, uncache) {\n _isString(target) && (target = toArray(target)[0]); //in case selector text or an array is passed in\n\n var getter = _getCache(target || {}).get,\n format = unit ? _passThrough : _numericIfPossible;\n\n unit === \"native\" && (unit = \"\");\n return !target ? target : !property ? function (property, unit, uncache) {\n return format((_plugins[property] && _plugins[property].get || getter)(target, property, unit, uncache));\n } : format((_plugins[property] && _plugins[property].get || getter)(target, property, unit, uncache));\n },\n quickSetter: function quickSetter(target, property, unit) {\n target = toArray(target);\n\n if (target.length > 1) {\n var setters = target.map(function (t) {\n return gsap.quickSetter(t, property, unit);\n }),\n l = setters.length;\n return function (value) {\n var i = l;\n\n while (i--) {\n setters[i](value);\n }\n };\n }\n\n target = target[0] || {};\n\n var Plugin = _plugins[property],\n cache = _getCache(target),\n p = cache.harness && (cache.harness.aliases || {})[property] || property,\n // in case it's an alias, like \"rotate\" for \"rotation\".\n setter = Plugin ? function (value) {\n var p = new Plugin();\n _quickTween._pt = 0;\n p.init(target, unit ? value + unit : value, _quickTween, 0, [target]);\n p.render(1, p);\n _quickTween._pt && _renderPropTweens(1, _quickTween);\n } : cache.set(target, p);\n\n return Plugin ? setter : function (value) {\n return setter(target, p, unit ? value + unit : value, cache, 1);\n };\n },\n quickTo: function quickTo(target, property, vars) {\n var _merge2;\n\n var tween = gsap.to(target, _merge((_merge2 = {}, _merge2[property] = \"+=0.1\", _merge2.paused = true, _merge2), vars || {})),\n func = function func(value, start, startIsRelative) {\n return tween.resetTo(property, value, start, startIsRelative);\n };\n\n func.tween = tween;\n return func;\n },\n isTweening: function isTweening(targets) {\n return _globalTimeline.getTweensOf(targets, true).length > 0;\n },\n defaults: function defaults(value) {\n value && value.ease && (value.ease = _parseEase(value.ease, _defaults.ease));\n return _mergeDeep(_defaults, value || {});\n },\n config: function config(value) {\n return _mergeDeep(_config, value || {});\n },\n registerEffect: function registerEffect(_ref3) {\n var name = _ref3.name,\n effect = _ref3.effect,\n plugins = _ref3.plugins,\n defaults = _ref3.defaults,\n extendTimeline = _ref3.extendTimeline;\n (plugins || \"\").split(\",\").forEach(function (pluginName) {\n return pluginName && !_plugins[pluginName] && !_globals[pluginName] && _warn(name + \" effect requires \" + pluginName + \" plugin.\");\n });\n\n _effects[name] = function (targets, vars, tl) {\n return effect(toArray(targets), _setDefaults(vars || {}, defaults), tl);\n };\n\n if (extendTimeline) {\n Timeline.prototype[name] = function (targets, vars, position) {\n return this.add(_effects[name](targets, _isObject(vars) ? vars : (position = vars) && {}, this), position);\n };\n }\n },\n registerEase: function registerEase(name, ease) {\n _easeMap[name] = _parseEase(ease);\n },\n parseEase: function parseEase(ease, defaultEase) {\n return arguments.length ? _parseEase(ease, defaultEase) : _easeMap;\n },\n getById: function getById(id) {\n return _globalTimeline.getById(id);\n },\n exportRoot: function exportRoot(vars, includeDelayedCalls) {\n if (vars === void 0) {\n vars = {};\n }\n\n var tl = new Timeline(vars),\n child,\n next;\n tl.smoothChildTiming = _isNotFalse(vars.smoothChildTiming);\n\n _globalTimeline.remove(tl);\n\n tl._dp = 0; //otherwise it'll get re-activated when adding children and be re-introduced into _globalTimeline's linked list (then added to itself).\n\n tl._time = tl._tTime = _globalTimeline._time;\n child = _globalTimeline._first;\n\n while (child) {\n next = child._next;\n\n if (includeDelayedCalls || !(!child._dur && child instanceof Tween && child.vars.onComplete === child._targets[0])) {\n _addToTimeline(tl, child, child._start - child._delay);\n }\n\n child = next;\n }\n\n _addToTimeline(_globalTimeline, tl, 0);\n\n return tl;\n },\n context: function context(func, scope) {\n return func ? new Context(func, scope) : _context;\n },\n matchMedia: function matchMedia(scope) {\n return new MatchMedia(scope);\n },\n matchMediaRefresh: function matchMediaRefresh() {\n return _media.forEach(function (c) {\n var cond = c.conditions,\n found,\n p;\n\n for (p in cond) {\n if (cond[p]) {\n cond[p] = false;\n found = 1;\n }\n }\n\n found && c.revert();\n }) || _onMediaChange();\n },\n addEventListener: function addEventListener(type, callback) {\n var a = _listeners[type] || (_listeners[type] = []);\n ~a.indexOf(callback) || a.push(callback);\n },\n removeEventListener: function removeEventListener(type, callback) {\n var a = _listeners[type],\n i = a && a.indexOf(callback);\n i >= 0 && a.splice(i, 1);\n },\n utils: {\n wrap: wrap,\n wrapYoyo: wrapYoyo,\n distribute: distribute,\n random: random,\n snap: snap,\n normalize: normalize,\n getUnit: getUnit,\n clamp: clamp,\n splitColor: splitColor,\n toArray: toArray,\n selector: selector,\n mapRange: mapRange,\n pipe: pipe,\n unitize: unitize,\n interpolate: interpolate,\n shuffle: shuffle\n },\n install: _install,\n effects: _effects,\n ticker: _ticker,\n updateRoot: Timeline.updateRoot,\n plugins: _plugins,\n globalTimeline: _globalTimeline,\n core: {\n PropTween: PropTween,\n globals: _addGlobal,\n Tween: Tween,\n Timeline: Timeline,\n Animation: Animation,\n getCache: _getCache,\n _removeLinkedListItem: _removeLinkedListItem,\n reverting: function reverting() {\n return _reverting;\n },\n context: function context(toAdd) {\n if (toAdd && _context) {\n _context.data.push(toAdd);\n\n toAdd._ctx = _context;\n }\n\n return _context;\n },\n suppressOverwrites: function suppressOverwrites(value) {\n return _suppressOverwrites = value;\n }\n }\n};\n\n_forEachName(\"to,from,fromTo,delayedCall,set,killTweensOf\", function (name) {\n return _gsap[name] = Tween[name];\n});\n\n_ticker.add(Timeline.updateRoot);\n\n_quickTween = _gsap.to({}, {\n duration: 0\n}); // ---- EXTRA PLUGINS --------------------------------------------------------\n\nvar _getPluginPropTween = function _getPluginPropTween(plugin, prop) {\n var pt = plugin._pt;\n\n while (pt && pt.p !== prop && pt.op !== prop && pt.fp !== prop) {\n pt = pt._next;\n }\n\n return pt;\n},\n _addModifiers = function _addModifiers(tween, modifiers) {\n var targets = tween._targets,\n p,\n i,\n pt;\n\n for (p in modifiers) {\n i = targets.length;\n\n while (i--) {\n pt = tween._ptLookup[i][p];\n\n if (pt && (pt = pt.d)) {\n if (pt._pt) {\n // is a plugin\n pt = _getPluginPropTween(pt, p);\n }\n\n pt && pt.modifier && pt.modifier(modifiers[p], tween, targets[i], p);\n }\n }\n }\n},\n _buildModifierPlugin = function _buildModifierPlugin(name, modifier) {\n return {\n name: name,\n rawVars: 1,\n //don't pre-process function-based values or \"random()\" strings.\n init: function init(target, vars, tween) {\n tween._onInit = function (tween) {\n var temp, p;\n\n if (_isString(vars)) {\n temp = {};\n\n _forEachName(vars, function (name) {\n return temp[name] = 1;\n }); //if the user passes in a comma-delimited list of property names to roundProps, like \"x,y\", we round to whole numbers.\n\n\n vars = temp;\n }\n\n if (modifier) {\n temp = {};\n\n for (p in vars) {\n temp[p] = modifier(vars[p]);\n }\n\n vars = temp;\n }\n\n _addModifiers(tween, vars);\n };\n }\n };\n}; //register core plugins\n\n\nexport var gsap = _gsap.registerPlugin({\n name: \"attr\",\n init: function init(target, vars, tween, index, targets) {\n var p, pt, v;\n this.tween = tween;\n\n for (p in vars) {\n v = target.getAttribute(p) || \"\";\n pt = this.add(target, \"setAttribute\", (v || 0) + \"\", vars[p], index, targets, 0, 0, p);\n pt.op = p;\n pt.b = v; // record the beginning value so we can revert()\n\n this._props.push(p);\n }\n },\n render: function render(ratio, data) {\n var pt = data._pt;\n\n while (pt) {\n _reverting ? pt.set(pt.t, pt.p, pt.b, pt) : pt.r(ratio, pt.d); // if reverting, go back to the original (pt.b)\n\n pt = pt._next;\n }\n }\n}, {\n name: \"endArray\",\n init: function init(target, value) {\n var i = value.length;\n\n while (i--) {\n this.add(target, i, target[i] || 0, value[i], 0, 0, 0, 0, 0, 1);\n }\n }\n}, _buildModifierPlugin(\"roundProps\", _roundModifier), _buildModifierPlugin(\"modifiers\"), _buildModifierPlugin(\"snap\", snap)) || _gsap; //to prevent the core plugins from being dropped via aggressive tree shaking, we must include them in the variable declaration in this way.\n\nTween.version = Timeline.version = gsap.version = \"3.12.5\";\n_coreReady = 1;\n_windowExists() && _wake();\nvar Power0 = _easeMap.Power0,\n Power1 = _easeMap.Power1,\n Power2 = _easeMap.Power2,\n Power3 = _easeMap.Power3,\n Power4 = _easeMap.Power4,\n Linear = _easeMap.Linear,\n Quad = _easeMap.Quad,\n Cubic = _easeMap.Cubic,\n Quart = _easeMap.Quart,\n Quint = _easeMap.Quint,\n Strong = _easeMap.Strong,\n Elastic = _easeMap.Elastic,\n Back = _easeMap.Back,\n SteppedEase = _easeMap.SteppedEase,\n Bounce = _easeMap.Bounce,\n Sine = _easeMap.Sine,\n Expo = _easeMap.Expo,\n Circ = _easeMap.Circ;\nexport { Power0, Power1, Power2, Power3, Power4, Linear, Quad, Cubic, Quart, Quint, Strong, Elastic, Back, SteppedEase, Bounce, Sine, Expo, Circ };\nexport { Tween as TweenMax, Tween as TweenLite, Timeline as TimelineMax, Timeline as TimelineLite, gsap as default, wrap, wrapYoyo, distribute, random, snap, normalize, getUnit, clamp, splitColor, toArray, selector, mapRange, pipe, unitize, interpolate, shuffle }; //export some internal methods/orojects for use in CSSPlugin so that we can externalize that file and allow custom builds that exclude it.\n\nexport { _getProperty, _numExp, _numWithUnitExp, _isString, _isUndefined, _renderComplexString, _relExp, _setDefaults, _removeLinkedListItem, _forEachName, _sortPropTweensByPriority, _colorStringFilter, _replaceRandom, _checkPlugin, _plugins, _ticker, _config, _roundModifier, _round, _missingPlugin, _getSetter, _getCache, _colorExp, _parseRelative };","/*!\n * CSSPlugin 3.12.5\n * https://gsap.com\n *\n * Copyright 2008-2024, GreenSock. All rights reserved.\n * Subject to the terms at https://gsap.com/standard-license or for\n * Club GSAP members, the agreement issued with that membership.\n * @author: Jack Doyle, jack@greensock.com\n*/\n\n/* eslint-disable */\nimport { gsap, _getProperty, _numExp, _numWithUnitExp, getUnit, _isString, _isUndefined, _renderComplexString, _relExp, _forEachName, _sortPropTweensByPriority, _colorStringFilter, _checkPlugin, _replaceRandom, _plugins, GSCache, PropTween, _config, _ticker, _round, _missingPlugin, _getSetter, _getCache, _colorExp, _parseRelative, _setDefaults, _removeLinkedListItem //for the commented-out className feature.\n} from \"./gsap-core.js\";\n\nvar _win,\n _doc,\n _docElement,\n _pluginInitted,\n _tempDiv,\n _tempDivStyler,\n _recentSetterPlugin,\n _reverting,\n _windowExists = function _windowExists() {\n return typeof window !== \"undefined\";\n},\n _transformProps = {},\n _RAD2DEG = 180 / Math.PI,\n _DEG2RAD = Math.PI / 180,\n _atan2 = Math.atan2,\n _bigNum = 1e8,\n _capsExp = /([A-Z])/g,\n _horizontalExp = /(left|right|width|margin|padding|x)/i,\n _complexExp = /[\\s,\\(]\\S/,\n _propertyAliases = {\n autoAlpha: \"opacity,visibility\",\n scale: \"scaleX,scaleY\",\n alpha: \"opacity\"\n},\n _renderCSSProp = function _renderCSSProp(ratio, data) {\n return data.set(data.t, data.p, Math.round((data.s + data.c * ratio) * 10000) / 10000 + data.u, data);\n},\n _renderPropWithEnd = function _renderPropWithEnd(ratio, data) {\n return data.set(data.t, data.p, ratio === 1 ? data.e : Math.round((data.s + data.c * ratio) * 10000) / 10000 + data.u, data);\n},\n _renderCSSPropWithBeginning = function _renderCSSPropWithBeginning(ratio, data) {\n return data.set(data.t, data.p, ratio ? Math.round((data.s + data.c * ratio) * 10000) / 10000 + data.u : data.b, data);\n},\n //if units change, we need a way to render the original unit/value when the tween goes all the way back to the beginning (ratio:0)\n_renderRoundedCSSProp = function _renderRoundedCSSProp(ratio, data) {\n var value = data.s + data.c * ratio;\n data.set(data.t, data.p, ~~(value + (value < 0 ? -.5 : .5)) + data.u, data);\n},\n _renderNonTweeningValue = function _renderNonTweeningValue(ratio, data) {\n return data.set(data.t, data.p, ratio ? data.e : data.b, data);\n},\n _renderNonTweeningValueOnlyAtEnd = function _renderNonTweeningValueOnlyAtEnd(ratio, data) {\n return data.set(data.t, data.p, ratio !== 1 ? data.b : data.e, data);\n},\n _setterCSSStyle = function _setterCSSStyle(target, property, value) {\n return target.style[property] = value;\n},\n _setterCSSProp = function _setterCSSProp(target, property, value) {\n return target.style.setProperty(property, value);\n},\n _setterTransform = function _setterTransform(target, property, value) {\n return target._gsap[property] = value;\n},\n _setterScale = function _setterScale(target, property, value) {\n return target._gsap.scaleX = target._gsap.scaleY = value;\n},\n _setterScaleWithRender = function _setterScaleWithRender(target, property, value, data, ratio) {\n var cache = target._gsap;\n cache.scaleX = cache.scaleY = value;\n cache.renderTransform(ratio, cache);\n},\n _setterTransformWithRender = function _setterTransformWithRender(target, property, value, data, ratio) {\n var cache = target._gsap;\n cache[property] = value;\n cache.renderTransform(ratio, cache);\n},\n _transformProp = \"transform\",\n _transformOriginProp = _transformProp + \"Origin\",\n _saveStyle = function _saveStyle(property, isNotCSS) {\n var _this = this;\n\n var target = this.target,\n style = target.style,\n cache = target._gsap;\n\n if (property in _transformProps && style) {\n this.tfm = this.tfm || {};\n\n if (property !== \"transform\") {\n property = _propertyAliases[property] || property;\n ~property.indexOf(\",\") ? property.split(\",\").forEach(function (a) {\n return _this.tfm[a] = _get(target, a);\n }) : this.tfm[property] = cache.x ? cache[property] : _get(target, property); // note: scale would map to \"scaleX,scaleY\", thus we loop and apply them both.\n\n property === _transformOriginProp && (this.tfm.zOrigin = cache.zOrigin);\n } else {\n return _propertyAliases.transform.split(\",\").forEach(function (p) {\n return _saveStyle.call(_this, p, isNotCSS);\n });\n }\n\n if (this.props.indexOf(_transformProp) >= 0) {\n return;\n }\n\n if (cache.svg) {\n this.svgo = target.getAttribute(\"data-svg-origin\");\n this.props.push(_transformOriginProp, isNotCSS, \"\");\n }\n\n property = _transformProp;\n }\n\n (style || isNotCSS) && this.props.push(property, isNotCSS, style[property]);\n},\n _removeIndependentTransforms = function _removeIndependentTransforms(style) {\n if (style.translate) {\n style.removeProperty(\"translate\");\n style.removeProperty(\"scale\");\n style.removeProperty(\"rotate\");\n }\n},\n _revertStyle = function _revertStyle() {\n var props = this.props,\n target = this.target,\n style = target.style,\n cache = target._gsap,\n i,\n p;\n\n for (i = 0; i < props.length; i += 3) {\n // stored like this: property, isNotCSS, value\n props[i + 1] ? target[props[i]] = props[i + 2] : props[i + 2] ? style[props[i]] = props[i + 2] : style.removeProperty(props[i].substr(0, 2) === \"--\" ? props[i] : props[i].replace(_capsExp, \"-$1\").toLowerCase());\n }\n\n if (this.tfm) {\n for (p in this.tfm) {\n cache[p] = this.tfm[p];\n }\n\n if (cache.svg) {\n cache.renderTransform();\n target.setAttribute(\"data-svg-origin\", this.svgo || \"\");\n }\n\n i = _reverting();\n\n if ((!i || !i.isStart) && !style[_transformProp]) {\n _removeIndependentTransforms(style);\n\n if (cache.zOrigin && style[_transformOriginProp]) {\n style[_transformOriginProp] += \" \" + cache.zOrigin + \"px\"; // since we're uncaching, we must put the zOrigin back into the transformOrigin so that we can pull it out accurately when we parse again. Otherwise, we'd lose the z portion of the origin since we extract it to protect from Safari bugs.\n\n cache.zOrigin = 0;\n cache.renderTransform();\n }\n\n cache.uncache = 1; // if it's a startAt that's being reverted in the _initTween() of the core, we don't need to uncache transforms. This is purely a performance optimization.\n }\n }\n},\n _getStyleSaver = function _getStyleSaver(target, properties) {\n var saver = {\n target: target,\n props: [],\n revert: _revertStyle,\n save: _saveStyle\n };\n target._gsap || gsap.core.getCache(target); // just make sure there's a _gsap cache defined because we read from it in _saveStyle() and it's more efficient to just check it here once.\n\n properties && properties.split(\",\").forEach(function (p) {\n return saver.save(p);\n });\n return saver;\n},\n _supports3D,\n _createElement = function _createElement(type, ns) {\n var e = _doc.createElementNS ? _doc.createElementNS((ns || \"http://www.w3.org/1999/xhtml\").replace(/^https/, \"http\"), type) : _doc.createElement(type); //some servers swap in https for http in the namespace which can break things, making \"style\" inaccessible.\n\n return e && e.style ? e : _doc.createElement(type); //some environments won't allow access to the element's style when created with a namespace in which case we default to the standard createElement() to work around the issue. Also note that when GSAP is embedded directly inside an SVG file, createElement() won't allow access to the style object in Firefox (see https://gsap.com/forums/topic/20215-problem-using-tweenmax-in-standalone-self-containing-svg-file-err-cannot-set-property-csstext-of-undefined/).\n},\n _getComputedProperty = function _getComputedProperty(target, property, skipPrefixFallback) {\n var cs = getComputedStyle(target);\n return cs[property] || cs.getPropertyValue(property.replace(_capsExp, \"-$1\").toLowerCase()) || cs.getPropertyValue(property) || !skipPrefixFallback && _getComputedProperty(target, _checkPropPrefix(property) || property, 1) || \"\"; //css variables may not need caps swapped out for dashes and lowercase.\n},\n _prefixes = \"O,Moz,ms,Ms,Webkit\".split(\",\"),\n _checkPropPrefix = function _checkPropPrefix(property, element, preferPrefix) {\n var e = element || _tempDiv,\n s = e.style,\n i = 5;\n\n if (property in s && !preferPrefix) {\n return property;\n }\n\n property = property.charAt(0).toUpperCase() + property.substr(1);\n\n while (i-- && !(_prefixes[i] + property in s)) {}\n\n return i < 0 ? null : (i === 3 ? \"ms\" : i >= 0 ? _prefixes[i] : \"\") + property;\n},\n _initCore = function _initCore() {\n if (_windowExists() && window.document) {\n _win = window;\n _doc = _win.document;\n _docElement = _doc.documentElement;\n _tempDiv = _createElement(\"div\") || {\n style: {}\n };\n _tempDivStyler = _createElement(\"div\");\n _transformProp = _checkPropPrefix(_transformProp);\n _transformOriginProp = _transformProp + \"Origin\";\n _tempDiv.style.cssText = \"border-width:0;line-height:0;position:absolute;padding:0\"; //make sure to override certain properties that may contaminate measurements, in case the user has overreaching style sheets.\n\n _supports3D = !!_checkPropPrefix(\"perspective\");\n _reverting = gsap.core.reverting;\n _pluginInitted = 1;\n }\n},\n _getBBoxHack = function _getBBoxHack(swapIfPossible) {\n //works around issues in some browsers (like Firefox) that don't correctly report getBBox() on SVG elements inside a element and/or . We try creating an SVG, adding it to the documentElement and toss the element in there so that it's definitely part of the rendering tree, then grab the bbox and if it works, we actually swap out the original getBBox() method for our own that does these extra steps whenever getBBox is needed. This helps ensure that performance is optimal (only do all these extra steps when absolutely necessary...most elements don't need it).\n var svg = _createElement(\"svg\", this.ownerSVGElement && this.ownerSVGElement.getAttribute(\"xmlns\") || \"http://www.w3.org/2000/svg\"),\n oldParent = this.parentNode,\n oldSibling = this.nextSibling,\n oldCSS = this.style.cssText,\n bbox;\n\n _docElement.appendChild(svg);\n\n svg.appendChild(this);\n this.style.display = \"block\";\n\n if (swapIfPossible) {\n try {\n bbox = this.getBBox();\n this._gsapBBox = this.getBBox; //store the original\n\n this.getBBox = _getBBoxHack;\n } catch (e) {}\n } else if (this._gsapBBox) {\n bbox = this._gsapBBox();\n }\n\n if (oldParent) {\n if (oldSibling) {\n oldParent.insertBefore(this, oldSibling);\n } else {\n oldParent.appendChild(this);\n }\n }\n\n _docElement.removeChild(svg);\n\n this.style.cssText = oldCSS;\n return bbox;\n},\n _getAttributeFallbacks = function _getAttributeFallbacks(target, attributesArray) {\n var i = attributesArray.length;\n\n while (i--) {\n if (target.hasAttribute(attributesArray[i])) {\n return target.getAttribute(attributesArray[i]);\n }\n }\n},\n _getBBox = function _getBBox(target) {\n var bounds;\n\n try {\n bounds = target.getBBox(); //Firefox throws errors if you try calling getBBox() on an SVG element that's not rendered (like in a or ). https://bugzilla.mozilla.org/show_bug.cgi?id=612118\n } catch (error) {\n bounds = _getBBoxHack.call(target, true);\n }\n\n bounds && (bounds.width || bounds.height) || target.getBBox === _getBBoxHack || (bounds = _getBBoxHack.call(target, true)); //some browsers (like Firefox) misreport the bounds if the element has zero width and height (it just assumes it's at x:0, y:0), thus we need to manually grab the position in that case.\n\n return bounds && !bounds.width && !bounds.x && !bounds.y ? {\n x: +_getAttributeFallbacks(target, [\"x\", \"cx\", \"x1\"]) || 0,\n y: +_getAttributeFallbacks(target, [\"y\", \"cy\", \"y1\"]) || 0,\n width: 0,\n height: 0\n } : bounds;\n},\n _isSVG = function _isSVG(e) {\n return !!(e.getCTM && (!e.parentNode || e.ownerSVGElement) && _getBBox(e));\n},\n //reports if the element is an SVG on which getBBox() actually works\n_removeProperty = function _removeProperty(target, property) {\n if (property) {\n var style = target.style,\n first2Chars;\n\n if (property in _transformProps && property !== _transformOriginProp) {\n property = _transformProp;\n }\n\n if (style.removeProperty) {\n first2Chars = property.substr(0, 2);\n\n if (first2Chars === \"ms\" || property.substr(0, 6) === \"webkit\") {\n //Microsoft and some Webkit browsers don't conform to the standard of capitalizing the first prefix character, so we adjust so that when we prefix the caps with a dash, it's correct (otherwise it'd be \"ms-transform\" instead of \"-ms-transform\" for IE9, for example)\n property = \"-\" + property;\n }\n\n style.removeProperty(first2Chars === \"--\" ? property : property.replace(_capsExp, \"-$1\").toLowerCase());\n } else {\n //note: old versions of IE use \"removeAttribute()\" instead of \"removeProperty()\"\n style.removeAttribute(property);\n }\n }\n},\n _addNonTweeningPT = function _addNonTweeningPT(plugin, target, property, beginning, end, onlySetAtEnd) {\n var pt = new PropTween(plugin._pt, target, property, 0, 1, onlySetAtEnd ? _renderNonTweeningValueOnlyAtEnd : _renderNonTweeningValue);\n plugin._pt = pt;\n pt.b = beginning;\n pt.e = end;\n\n plugin._props.push(property);\n\n return pt;\n},\n _nonConvertibleUnits = {\n deg: 1,\n rad: 1,\n turn: 1\n},\n _nonStandardLayouts = {\n grid: 1,\n flex: 1\n},\n //takes a single value like 20px and converts it to the unit specified, like \"%\", returning only the numeric amount.\n_convertToUnit = function _convertToUnit(target, property, value, unit) {\n var curValue = parseFloat(value) || 0,\n curUnit = (value + \"\").trim().substr((curValue + \"\").length) || \"px\",\n // some browsers leave extra whitespace at the beginning of CSS variables, hence the need to trim()\n style = _tempDiv.style,\n horizontal = _horizontalExp.test(property),\n isRootSVG = target.tagName.toLowerCase() === \"svg\",\n measureProperty = (isRootSVG ? \"client\" : \"offset\") + (horizontal ? \"Width\" : \"Height\"),\n amount = 100,\n toPixels = unit === \"px\",\n toPercent = unit === \"%\",\n px,\n parent,\n cache,\n isSVG;\n\n if (unit === curUnit || !curValue || _nonConvertibleUnits[unit] || _nonConvertibleUnits[curUnit]) {\n return curValue;\n }\n\n curUnit !== \"px\" && !toPixels && (curValue = _convertToUnit(target, property, value, \"px\"));\n isSVG = target.getCTM && _isSVG(target);\n\n if ((toPercent || curUnit === \"%\") && (_transformProps[property] || ~property.indexOf(\"adius\"))) {\n px = isSVG ? target.getBBox()[horizontal ? \"width\" : \"height\"] : target[measureProperty];\n return _round(toPercent ? curValue / px * amount : curValue / 100 * px);\n }\n\n style[horizontal ? \"width\" : \"height\"] = amount + (toPixels ? curUnit : unit);\n parent = ~property.indexOf(\"adius\") || unit === \"em\" && target.appendChild && !isRootSVG ? target : target.parentNode;\n\n if (isSVG) {\n parent = (target.ownerSVGElement || {}).parentNode;\n }\n\n if (!parent || parent === _doc || !parent.appendChild) {\n parent = _doc.body;\n }\n\n cache = parent._gsap;\n\n if (cache && toPercent && cache.width && horizontal && cache.time === _ticker.time && !cache.uncache) {\n return _round(curValue / cache.width * amount);\n } else {\n if (toPercent && (property === \"height\" || property === \"width\")) {\n // if we're dealing with width/height that's inside a container with padding and/or it's a flexbox/grid container, we must apply it to the target itself rather than the _tempDiv in order to ensure complete accuracy, factoring in the parent's padding.\n var v = target.style[property];\n target.style[property] = amount + unit;\n px = target[measureProperty];\n v ? target.style[property] = v : _removeProperty(target, property);\n } else {\n (toPercent || curUnit === \"%\") && !_nonStandardLayouts[_getComputedProperty(parent, \"display\")] && (style.position = _getComputedProperty(target, \"position\"));\n parent === target && (style.position = \"static\"); // like for borderRadius, if it's a % we must have it relative to the target itself but that may not have position: relative or position: absolute in which case it'd go up the chain until it finds its offsetParent (bad). position: static protects against that.\n\n parent.appendChild(_tempDiv);\n px = _tempDiv[measureProperty];\n parent.removeChild(_tempDiv);\n style.position = \"absolute\";\n }\n\n if (horizontal && toPercent) {\n cache = _getCache(parent);\n cache.time = _ticker.time;\n cache.width = parent[measureProperty];\n }\n }\n\n return _round(toPixels ? px * curValue / amount : px && curValue ? amount / px * curValue : 0);\n},\n _get = function _get(target, property, unit, uncache) {\n var value;\n _pluginInitted || _initCore();\n\n if (property in _propertyAliases && property !== \"transform\") {\n property = _propertyAliases[property];\n\n if (~property.indexOf(\",\")) {\n property = property.split(\",\")[0];\n }\n }\n\n if (_transformProps[property] && property !== \"transform\") {\n value = _parseTransform(target, uncache);\n value = property !== \"transformOrigin\" ? value[property] : value.svg ? value.origin : _firstTwoOnly(_getComputedProperty(target, _transformOriginProp)) + \" \" + value.zOrigin + \"px\";\n } else {\n value = target.style[property];\n\n if (!value || value === \"auto\" || uncache || ~(value + \"\").indexOf(\"calc(\")) {\n value = _specialProps[property] && _specialProps[property](target, property, unit) || _getComputedProperty(target, property) || _getProperty(target, property) || (property === \"opacity\" ? 1 : 0); // note: some browsers, like Firefox, don't report borderRadius correctly! Instead, it only reports every corner like borderTopLeftRadius\n }\n }\n\n return unit && !~(value + \"\").trim().indexOf(\" \") ? _convertToUnit(target, property, value, unit) + unit : value;\n},\n _tweenComplexCSSString = function _tweenComplexCSSString(target, prop, start, end) {\n // note: we call _tweenComplexCSSString.call(pluginInstance...) to ensure that it's scoped properly. We may call it from within a plugin too, thus \"this\" would refer to the plugin.\n if (!start || start === \"none\") {\n // some browsers like Safari actually PREFER the prefixed property and mis-report the unprefixed value like clipPath (BUG). In other words, even though clipPath exists in the style (\"clipPath\" in target.style) and it's set in the CSS properly (along with -webkit-clip-path), Safari reports clipPath as \"none\" whereas WebkitClipPath reports accurately like \"ellipse(100% 0% at 50% 0%)\", so in this case we must SWITCH to using the prefixed property instead. See https://gsap.com/forums/topic/18310-clippath-doesnt-work-on-ios/\n var p = _checkPropPrefix(prop, target, 1),\n s = p && _getComputedProperty(target, p, 1);\n\n if (s && s !== start) {\n prop = p;\n start = s;\n } else if (prop === \"borderColor\") {\n start = _getComputedProperty(target, \"borderTopColor\"); // Firefox bug: always reports \"borderColor\" as \"\", so we must fall back to borderTopColor. See https://gsap.com/forums/topic/24583-how-to-return-colors-that-i-had-after-reverse/\n }\n }\n\n var pt = new PropTween(this._pt, target.style, prop, 0, 1, _renderComplexString),\n index = 0,\n matchIndex = 0,\n a,\n result,\n startValues,\n startNum,\n color,\n startValue,\n endValue,\n endNum,\n chunk,\n endUnit,\n startUnit,\n endValues;\n pt.b = start;\n pt.e = end;\n start += \"\"; // ensure values are strings\n\n end += \"\";\n\n if (end === \"auto\") {\n startValue = target.style[prop];\n target.style[prop] = end;\n end = _getComputedProperty(target, prop) || end;\n startValue ? target.style[prop] = startValue : _removeProperty(target, prop);\n }\n\n a = [start, end];\n\n _colorStringFilter(a); // pass an array with the starting and ending values and let the filter do whatever it needs to the values. If colors are found, it returns true and then we must match where the color shows up order-wise because for things like boxShadow, sometimes the browser provides the computed values with the color FIRST, but the user provides it with the color LAST, so flip them if necessary. Same for drop-shadow().\n\n\n start = a[0];\n end = a[1];\n startValues = start.match(_numWithUnitExp) || [];\n endValues = end.match(_numWithUnitExp) || [];\n\n if (endValues.length) {\n while (result = _numWithUnitExp.exec(end)) {\n endValue = result[0];\n chunk = end.substring(index, result.index);\n\n if (color) {\n color = (color + 1) % 5;\n } else if (chunk.substr(-5) === \"rgba(\" || chunk.substr(-5) === \"hsla(\") {\n color = 1;\n }\n\n if (endValue !== (startValue = startValues[matchIndex++] || \"\")) {\n startNum = parseFloat(startValue) || 0;\n startUnit = startValue.substr((startNum + \"\").length);\n endValue.charAt(1) === \"=\" && (endValue = _parseRelative(startNum, endValue) + startUnit);\n endNum = parseFloat(endValue);\n endUnit = endValue.substr((endNum + \"\").length);\n index = _numWithUnitExp.lastIndex - endUnit.length;\n\n if (!endUnit) {\n //if something like \"perspective:300\" is passed in and we must add a unit to the end\n endUnit = endUnit || _config.units[prop] || startUnit;\n\n if (index === end.length) {\n end += endUnit;\n pt.e += endUnit;\n }\n }\n\n if (startUnit !== endUnit) {\n startNum = _convertToUnit(target, prop, startValue, endUnit) || 0;\n } // these nested PropTweens are handled in a special way - we'll never actually call a render or setter method on them. We'll just loop through them in the parent complex string PropTween's render method.\n\n\n pt._pt = {\n _next: pt._pt,\n p: chunk || matchIndex === 1 ? chunk : \",\",\n //note: SVG spec allows omission of comma/space when a negative sign is wedged between two numbers, like 2.5-5.3 instead of 2.5,-5.3 but when tweening, the negative value may switch to positive, so we insert the comma just in case.\n s: startNum,\n c: endNum - startNum,\n m: color && color < 4 || prop === \"zIndex\" ? Math.round : 0\n };\n }\n }\n\n pt.c = index < end.length ? end.substring(index, end.length) : \"\"; //we use the \"c\" of the PropTween to store the final part of the string (after the last number)\n } else {\n pt.r = prop === \"display\" && end === \"none\" ? _renderNonTweeningValueOnlyAtEnd : _renderNonTweeningValue;\n }\n\n _relExp.test(end) && (pt.e = 0); //if the end string contains relative values or dynamic random(...) values, delete the end it so that on the final render we don't actually set it to the string with += or -= characters (forces it to use the calculated value).\n\n this._pt = pt; //start the linked list with this new PropTween. Remember, we call _tweenComplexCSSString.call(pluginInstance...) to ensure that it's scoped properly. We may call it from within another plugin too, thus \"this\" would refer to the plugin.\n\n return pt;\n},\n _keywordToPercent = {\n top: \"0%\",\n bottom: \"100%\",\n left: \"0%\",\n right: \"100%\",\n center: \"50%\"\n},\n _convertKeywordsToPercentages = function _convertKeywordsToPercentages(value) {\n var split = value.split(\" \"),\n x = split[0],\n y = split[1] || \"50%\";\n\n if (x === \"top\" || x === \"bottom\" || y === \"left\" || y === \"right\") {\n //the user provided them in the wrong order, so flip them\n value = x;\n x = y;\n y = value;\n }\n\n split[0] = _keywordToPercent[x] || x;\n split[1] = _keywordToPercent[y] || y;\n return split.join(\" \");\n},\n _renderClearProps = function _renderClearProps(ratio, data) {\n if (data.tween && data.tween._time === data.tween._dur) {\n var target = data.t,\n style = target.style,\n props = data.u,\n cache = target._gsap,\n prop,\n clearTransforms,\n i;\n\n if (props === \"all\" || props === true) {\n style.cssText = \"\";\n clearTransforms = 1;\n } else {\n props = props.split(\",\");\n i = props.length;\n\n while (--i > -1) {\n prop = props[i];\n\n if (_transformProps[prop]) {\n clearTransforms = 1;\n prop = prop === \"transformOrigin\" ? _transformOriginProp : _transformProp;\n }\n\n _removeProperty(target, prop);\n }\n }\n\n if (clearTransforms) {\n _removeProperty(target, _transformProp);\n\n if (cache) {\n cache.svg && target.removeAttribute(\"transform\");\n\n _parseTransform(target, 1); // force all the cached values back to \"normal\"/identity, otherwise if there's another tween that's already set to render transforms on this element, it could display the wrong values.\n\n\n cache.uncache = 1;\n\n _removeIndependentTransforms(style);\n }\n }\n }\n},\n // note: specialProps should return 1 if (and only if) they have a non-zero priority. It indicates we need to sort the linked list.\n_specialProps = {\n clearProps: function clearProps(plugin, target, property, endValue, tween) {\n if (tween.data !== \"isFromStart\") {\n var pt = plugin._pt = new PropTween(plugin._pt, target, property, 0, 0, _renderClearProps);\n pt.u = endValue;\n pt.pr = -10;\n pt.tween = tween;\n\n plugin._props.push(property);\n\n return 1;\n }\n }\n /* className feature (about 0.4kb gzipped).\n , className(plugin, target, property, endValue, tween) {\n \tlet _renderClassName = (ratio, data) => {\n \t\t\tdata.css.render(ratio, data.css);\n \t\t\tif (!ratio || ratio === 1) {\n \t\t\t\tlet inline = data.rmv,\n \t\t\t\t\ttarget = data.t,\n \t\t\t\t\tp;\n \t\t\t\ttarget.setAttribute(\"class\", ratio ? data.e : data.b);\n \t\t\t\tfor (p in inline) {\n \t\t\t\t\t_removeProperty(target, p);\n \t\t\t\t}\n \t\t\t}\n \t\t},\n \t\t_getAllStyles = (target) => {\n \t\t\tlet styles = {},\n \t\t\t\tcomputed = getComputedStyle(target),\n \t\t\t\tp;\n \t\t\tfor (p in computed) {\n \t\t\t\tif (isNaN(p) && p !== \"cssText\" && p !== \"length\") {\n \t\t\t\t\tstyles[p] = computed[p];\n \t\t\t\t}\n \t\t\t}\n \t\t\t_setDefaults(styles, _parseTransform(target, 1));\n \t\t\treturn styles;\n \t\t},\n \t\tstartClassList = target.getAttribute(\"class\"),\n \t\tstyle = target.style,\n \t\tcssText = style.cssText,\n \t\tcache = target._gsap,\n \t\tclassPT = cache.classPT,\n \t\tinlineToRemoveAtEnd = {},\n \t\tdata = {t:target, plugin:plugin, rmv:inlineToRemoveAtEnd, b:startClassList, e:(endValue.charAt(1) !== \"=\") ? endValue : startClassList.replace(new RegExp(\"(?:\\\\s|^)\" + endValue.substr(2) + \"(?![\\\\w-])\"), \"\") + ((endValue.charAt(0) === \"+\") ? \" \" + endValue.substr(2) : \"\")},\n \t\tchangingVars = {},\n \t\tstartVars = _getAllStyles(target),\n \t\ttransformRelated = /(transform|perspective)/i,\n \t\tendVars, p;\n \tif (classPT) {\n \t\tclassPT.r(1, classPT.d);\n \t\t_removeLinkedListItem(classPT.d.plugin, classPT, \"_pt\");\n \t}\n \ttarget.setAttribute(\"class\", data.e);\n \tendVars = _getAllStyles(target, true);\n \ttarget.setAttribute(\"class\", startClassList);\n \tfor (p in endVars) {\n \t\tif (endVars[p] !== startVars[p] && !transformRelated.test(p)) {\n \t\t\tchangingVars[p] = endVars[p];\n \t\t\tif (!style[p] && style[p] !== \"0\") {\n \t\t\t\tinlineToRemoveAtEnd[p] = 1;\n \t\t\t}\n \t\t}\n \t}\n \tcache.classPT = plugin._pt = new PropTween(plugin._pt, target, \"className\", 0, 0, _renderClassName, data, 0, -11);\n \tif (style.cssText !== cssText) { //only apply if things change. Otherwise, in cases like a background-image that's pulled dynamically, it could cause a refresh. See https://gsap.com/forums/topic/20368-possible-gsap-bug-switching-classnames-in-chrome/.\n \t\tstyle.cssText = cssText; //we recorded cssText before we swapped classes and ran _getAllStyles() because in cases when a className tween is overwritten, we remove all the related tweening properties from that class change (otherwise class-specific stuff can't override properties we've directly set on the target's style object due to specificity).\n \t}\n \t_parseTransform(target, true); //to clear the caching of transforms\n \tdata.css = new gsap.plugins.css();\n \tdata.css.init(target, changingVars, tween);\n \tplugin._props.push(...data.css._props);\n \treturn 1;\n }\n */\n\n},\n\n/*\n * --------------------------------------------------------------------------------------\n * TRANSFORMS\n * --------------------------------------------------------------------------------------\n */\n_identity2DMatrix = [1, 0, 0, 1, 0, 0],\n _rotationalProperties = {},\n _isNullTransform = function _isNullTransform(value) {\n return value === \"matrix(1, 0, 0, 1, 0, 0)\" || value === \"none\" || !value;\n},\n _getComputedTransformMatrixAsArray = function _getComputedTransformMatrixAsArray(target) {\n var matrixString = _getComputedProperty(target, _transformProp);\n\n return _isNullTransform(matrixString) ? _identity2DMatrix : matrixString.substr(7).match(_numExp).map(_round);\n},\n _getMatrix = function _getMatrix(target, force2D) {\n var cache = target._gsap || _getCache(target),\n style = target.style,\n matrix = _getComputedTransformMatrixAsArray(target),\n parent,\n nextSibling,\n temp,\n addedToDOM;\n\n if (cache.svg && target.getAttribute(\"transform\")) {\n temp = target.transform.baseVal.consolidate().matrix; //ensures that even complex values like \"translate(50,60) rotate(135,0,0)\" are parsed because it mashes it into a matrix.\n\n matrix = [temp.a, temp.b, temp.c, temp.d, temp.e, temp.f];\n return matrix.join(\",\") === \"1,0,0,1,0,0\" ? _identity2DMatrix : matrix;\n } else if (matrix === _identity2DMatrix && !target.offsetParent && target !== _docElement && !cache.svg) {\n //note: if offsetParent is null, that means the element isn't in the normal document flow, like if it has display:none or one of its ancestors has display:none). Firefox returns null for getComputedStyle() if the element is in an iframe that has display:none. https://bugzilla.mozilla.org/show_bug.cgi?id=548397\n //browsers don't report transforms accurately unless the element is in the DOM and has a display value that's not \"none\". Firefox and Microsoft browsers have a partial bug where they'll report transforms even if display:none BUT not any percentage-based values like translate(-50%, 8px) will be reported as if it's translate(0, 8px).\n temp = style.display;\n style.display = \"block\";\n parent = target.parentNode;\n\n if (!parent || !target.offsetParent) {\n // note: in 3.3.0 we switched target.offsetParent to _doc.body.contains(target) to avoid [sometimes unnecessary] MutationObserver calls but that wasn't adequate because there are edge cases where nested position: fixed elements need to get reparented to accurately sense transforms. See https://github.com/greensock/GSAP/issues/388 and https://github.com/greensock/GSAP/issues/375\n addedToDOM = 1; //flag\n\n nextSibling = target.nextElementSibling;\n\n _docElement.appendChild(target); //we must add it to the DOM in order to get values properly\n\n }\n\n matrix = _getComputedTransformMatrixAsArray(target);\n temp ? style.display = temp : _removeProperty(target, \"display\");\n\n if (addedToDOM) {\n nextSibling ? parent.insertBefore(target, nextSibling) : parent ? parent.appendChild(target) : _docElement.removeChild(target);\n }\n }\n\n return force2D && matrix.length > 6 ? [matrix[0], matrix[1], matrix[4], matrix[5], matrix[12], matrix[13]] : matrix;\n},\n _applySVGOrigin = function _applySVGOrigin(target, origin, originIsAbsolute, smooth, matrixArray, pluginToAddPropTweensTo) {\n var cache = target._gsap,\n matrix = matrixArray || _getMatrix(target, true),\n xOriginOld = cache.xOrigin || 0,\n yOriginOld = cache.yOrigin || 0,\n xOffsetOld = cache.xOffset || 0,\n yOffsetOld = cache.yOffset || 0,\n a = matrix[0],\n b = matrix[1],\n c = matrix[2],\n d = matrix[3],\n tx = matrix[4],\n ty = matrix[5],\n originSplit = origin.split(\" \"),\n xOrigin = parseFloat(originSplit[0]) || 0,\n yOrigin = parseFloat(originSplit[1]) || 0,\n bounds,\n determinant,\n x,\n y;\n\n if (!originIsAbsolute) {\n bounds = _getBBox(target);\n xOrigin = bounds.x + (~originSplit[0].indexOf(\"%\") ? xOrigin / 100 * bounds.width : xOrigin);\n yOrigin = bounds.y + (~(originSplit[1] || originSplit[0]).indexOf(\"%\") ? yOrigin / 100 * bounds.height : yOrigin); // if (!(\"xOrigin\" in cache) && (xOrigin || yOrigin)) { // added in 3.12.3, reverted in 3.12.4; requires more exploration\n // \txOrigin -= bounds.x;\n // \tyOrigin -= bounds.y;\n // }\n } else if (matrix !== _identity2DMatrix && (determinant = a * d - b * c)) {\n //if it's zero (like if scaleX and scaleY are zero), skip it to avoid errors with dividing by zero.\n x = xOrigin * (d / determinant) + yOrigin * (-c / determinant) + (c * ty - d * tx) / determinant;\n y = xOrigin * (-b / determinant) + yOrigin * (a / determinant) - (a * ty - b * tx) / determinant;\n xOrigin = x;\n yOrigin = y; // theory: we only had to do this for smoothing and it assumes that the previous one was not originIsAbsolute.\n }\n\n if (smooth || smooth !== false && cache.smooth) {\n tx = xOrigin - xOriginOld;\n ty = yOrigin - yOriginOld;\n cache.xOffset = xOffsetOld + (tx * a + ty * c) - tx;\n cache.yOffset = yOffsetOld + (tx * b + ty * d) - ty;\n } else {\n cache.xOffset = cache.yOffset = 0;\n }\n\n cache.xOrigin = xOrigin;\n cache.yOrigin = yOrigin;\n cache.smooth = !!smooth;\n cache.origin = origin;\n cache.originIsAbsolute = !!originIsAbsolute;\n target.style[_transformOriginProp] = \"0px 0px\"; //otherwise, if someone sets an origin via CSS, it will likely interfere with the SVG transform attribute ones (because remember, we're baking the origin into the matrix() value).\n\n if (pluginToAddPropTweensTo) {\n _addNonTweeningPT(pluginToAddPropTweensTo, cache, \"xOrigin\", xOriginOld, xOrigin);\n\n _addNonTweeningPT(pluginToAddPropTweensTo, cache, \"yOrigin\", yOriginOld, yOrigin);\n\n _addNonTweeningPT(pluginToAddPropTweensTo, cache, \"xOffset\", xOffsetOld, cache.xOffset);\n\n _addNonTweeningPT(pluginToAddPropTweensTo, cache, \"yOffset\", yOffsetOld, cache.yOffset);\n }\n\n target.setAttribute(\"data-svg-origin\", xOrigin + \" \" + yOrigin);\n},\n _parseTransform = function _parseTransform(target, uncache) {\n var cache = target._gsap || new GSCache(target);\n\n if (\"x\" in cache && !uncache && !cache.uncache) {\n return cache;\n }\n\n var style = target.style,\n invertedScaleX = cache.scaleX < 0,\n px = \"px\",\n deg = \"deg\",\n cs = getComputedStyle(target),\n origin = _getComputedProperty(target, _transformOriginProp) || \"0\",\n x,\n y,\n z,\n scaleX,\n scaleY,\n rotation,\n rotationX,\n rotationY,\n skewX,\n skewY,\n perspective,\n xOrigin,\n yOrigin,\n matrix,\n angle,\n cos,\n sin,\n a,\n b,\n c,\n d,\n a12,\n a22,\n t1,\n t2,\n t3,\n a13,\n a23,\n a33,\n a42,\n a43,\n a32;\n x = y = z = rotation = rotationX = rotationY = skewX = skewY = perspective = 0;\n scaleX = scaleY = 1;\n cache.svg = !!(target.getCTM && _isSVG(target));\n\n if (cs.translate) {\n // accommodate independent transforms by combining them into normal ones.\n if (cs.translate !== \"none\" || cs.scale !== \"none\" || cs.rotate !== \"none\") {\n style[_transformProp] = (cs.translate !== \"none\" ? \"translate3d(\" + (cs.translate + \" 0 0\").split(\" \").slice(0, 3).join(\", \") + \") \" : \"\") + (cs.rotate !== \"none\" ? \"rotate(\" + cs.rotate + \") \" : \"\") + (cs.scale !== \"none\" ? \"scale(\" + cs.scale.split(\" \").join(\",\") + \") \" : \"\") + (cs[_transformProp] !== \"none\" ? cs[_transformProp] : \"\");\n }\n\n style.scale = style.rotate = style.translate = \"none\";\n }\n\n matrix = _getMatrix(target, cache.svg);\n\n if (cache.svg) {\n if (cache.uncache) {\n // if cache.uncache is true (and maybe if origin is 0,0), we need to set element.style.transformOrigin = (cache.xOrigin - bbox.x) + \"px \" + (cache.yOrigin - bbox.y) + \"px\". Previously we let the data-svg-origin stay instead, but when introducing revert(), it complicated things.\n t2 = target.getBBox();\n origin = cache.xOrigin - t2.x + \"px \" + (cache.yOrigin - t2.y) + \"px\";\n t1 = \"\";\n } else {\n t1 = !uncache && target.getAttribute(\"data-svg-origin\"); // Remember, to work around browser inconsistencies we always force SVG elements' transformOrigin to 0,0 and offset the translation accordingly.\n }\n\n _applySVGOrigin(target, t1 || origin, !!t1 || cache.originIsAbsolute, cache.smooth !== false, matrix);\n }\n\n xOrigin = cache.xOrigin || 0;\n yOrigin = cache.yOrigin || 0;\n\n if (matrix !== _identity2DMatrix) {\n a = matrix[0]; //a11\n\n b = matrix[1]; //a21\n\n c = matrix[2]; //a31\n\n d = matrix[3]; //a41\n\n x = a12 = matrix[4];\n y = a22 = matrix[5]; //2D matrix\n\n if (matrix.length === 6) {\n scaleX = Math.sqrt(a * a + b * b);\n scaleY = Math.sqrt(d * d + c * c);\n rotation = a || b ? _atan2(b, a) * _RAD2DEG : 0; //note: if scaleX is 0, we cannot accurately measure rotation. Same for skewX with a scaleY of 0. Therefore, we default to the previously recorded value (or zero if that doesn't exist).\n\n skewX = c || d ? _atan2(c, d) * _RAD2DEG + rotation : 0;\n skewX && (scaleY *= Math.abs(Math.cos(skewX * _DEG2RAD)));\n\n if (cache.svg) {\n x -= xOrigin - (xOrigin * a + yOrigin * c);\n y -= yOrigin - (xOrigin * b + yOrigin * d);\n } //3D matrix\n\n } else {\n a32 = matrix[6];\n a42 = matrix[7];\n a13 = matrix[8];\n a23 = matrix[9];\n a33 = matrix[10];\n a43 = matrix[11];\n x = matrix[12];\n y = matrix[13];\n z = matrix[14];\n angle = _atan2(a32, a33);\n rotationX = angle * _RAD2DEG; //rotationX\n\n if (angle) {\n cos = Math.cos(-angle);\n sin = Math.sin(-angle);\n t1 = a12 * cos + a13 * sin;\n t2 = a22 * cos + a23 * sin;\n t3 = a32 * cos + a33 * sin;\n a13 = a12 * -sin + a13 * cos;\n a23 = a22 * -sin + a23 * cos;\n a33 = a32 * -sin + a33 * cos;\n a43 = a42 * -sin + a43 * cos;\n a12 = t1;\n a22 = t2;\n a32 = t3;\n } //rotationY\n\n\n angle = _atan2(-c, a33);\n rotationY = angle * _RAD2DEG;\n\n if (angle) {\n cos = Math.cos(-angle);\n sin = Math.sin(-angle);\n t1 = a * cos - a13 * sin;\n t2 = b * cos - a23 * sin;\n t3 = c * cos - a33 * sin;\n a43 = d * sin + a43 * cos;\n a = t1;\n b = t2;\n c = t3;\n } //rotationZ\n\n\n angle = _atan2(b, a);\n rotation = angle * _RAD2DEG;\n\n if (angle) {\n cos = Math.cos(angle);\n sin = Math.sin(angle);\n t1 = a * cos + b * sin;\n t2 = a12 * cos + a22 * sin;\n b = b * cos - a * sin;\n a22 = a22 * cos - a12 * sin;\n a = t1;\n a12 = t2;\n }\n\n if (rotationX && Math.abs(rotationX) + Math.abs(rotation) > 359.9) {\n //when rotationY is set, it will often be parsed as 180 degrees different than it should be, and rotationX and rotation both being 180 (it looks the same), so we adjust for that here.\n rotationX = rotation = 0;\n rotationY = 180 - rotationY;\n }\n\n scaleX = _round(Math.sqrt(a * a + b * b + c * c));\n scaleY = _round(Math.sqrt(a22 * a22 + a32 * a32));\n angle = _atan2(a12, a22);\n skewX = Math.abs(angle) > 0.0002 ? angle * _RAD2DEG : 0;\n perspective = a43 ? 1 / (a43 < 0 ? -a43 : a43) : 0;\n }\n\n if (cache.svg) {\n //sense if there are CSS transforms applied on an SVG element in which case we must overwrite them when rendering. The transform attribute is more reliable cross-browser, but we can't just remove the CSS ones because they may be applied in a CSS rule somewhere (not just inline).\n t1 = target.getAttribute(\"transform\");\n cache.forceCSS = target.setAttribute(\"transform\", \"\") || !_isNullTransform(_getComputedProperty(target, _transformProp));\n t1 && target.setAttribute(\"transform\", t1);\n }\n }\n\n if (Math.abs(skewX) > 90 && Math.abs(skewX) < 270) {\n if (invertedScaleX) {\n scaleX *= -1;\n skewX += rotation <= 0 ? 180 : -180;\n rotation += rotation <= 0 ? 180 : -180;\n } else {\n scaleY *= -1;\n skewX += skewX <= 0 ? 180 : -180;\n }\n }\n\n uncache = uncache || cache.uncache;\n cache.x = x - ((cache.xPercent = x && (!uncache && cache.xPercent || (Math.round(target.offsetWidth / 2) === Math.round(-x) ? -50 : 0))) ? target.offsetWidth * cache.xPercent / 100 : 0) + px;\n cache.y = y - ((cache.yPercent = y && (!uncache && cache.yPercent || (Math.round(target.offsetHeight / 2) === Math.round(-y) ? -50 : 0))) ? target.offsetHeight * cache.yPercent / 100 : 0) + px;\n cache.z = z + px;\n cache.scaleX = _round(scaleX);\n cache.scaleY = _round(scaleY);\n cache.rotation = _round(rotation) + deg;\n cache.rotationX = _round(rotationX) + deg;\n cache.rotationY = _round(rotationY) + deg;\n cache.skewX = skewX + deg;\n cache.skewY = skewY + deg;\n cache.transformPerspective = perspective + px;\n\n if (cache.zOrigin = parseFloat(origin.split(\" \")[2]) || !uncache && cache.zOrigin || 0) {\n style[_transformOriginProp] = _firstTwoOnly(origin);\n }\n\n cache.xOffset = cache.yOffset = 0;\n cache.force3D = _config.force3D;\n cache.renderTransform = cache.svg ? _renderSVGTransforms : _supports3D ? _renderCSSTransforms : _renderNon3DTransforms;\n cache.uncache = 0;\n return cache;\n},\n _firstTwoOnly = function _firstTwoOnly(value) {\n return (value = value.split(\" \"))[0] + \" \" + value[1];\n},\n //for handling transformOrigin values, stripping out the 3rd dimension\n_addPxTranslate = function _addPxTranslate(target, start, value) {\n var unit = getUnit(start);\n return _round(parseFloat(start) + parseFloat(_convertToUnit(target, \"x\", value + \"px\", unit))) + unit;\n},\n _renderNon3DTransforms = function _renderNon3DTransforms(ratio, cache) {\n cache.z = \"0px\";\n cache.rotationY = cache.rotationX = \"0deg\";\n cache.force3D = 0;\n\n _renderCSSTransforms(ratio, cache);\n},\n _zeroDeg = \"0deg\",\n _zeroPx = \"0px\",\n _endParenthesis = \") \",\n _renderCSSTransforms = function _renderCSSTransforms(ratio, cache) {\n var _ref = cache || this,\n xPercent = _ref.xPercent,\n yPercent = _ref.yPercent,\n x = _ref.x,\n y = _ref.y,\n z = _ref.z,\n rotation = _ref.rotation,\n rotationY = _ref.rotationY,\n rotationX = _ref.rotationX,\n skewX = _ref.skewX,\n skewY = _ref.skewY,\n scaleX = _ref.scaleX,\n scaleY = _ref.scaleY,\n transformPerspective = _ref.transformPerspective,\n force3D = _ref.force3D,\n target = _ref.target,\n zOrigin = _ref.zOrigin,\n transforms = \"\",\n use3D = force3D === \"auto\" && ratio && ratio !== 1 || force3D === true; // Safari has a bug that causes it not to render 3D transform-origin values properly, so we force the z origin to 0, record it in the cache, and then do the math here to offset the translate values accordingly (basically do the 3D transform-origin part manually)\n\n\n if (zOrigin && (rotationX !== _zeroDeg || rotationY !== _zeroDeg)) {\n var angle = parseFloat(rotationY) * _DEG2RAD,\n a13 = Math.sin(angle),\n a33 = Math.cos(angle),\n cos;\n\n angle = parseFloat(rotationX) * _DEG2RAD;\n cos = Math.cos(angle);\n x = _addPxTranslate(target, x, a13 * cos * -zOrigin);\n y = _addPxTranslate(target, y, -Math.sin(angle) * -zOrigin);\n z = _addPxTranslate(target, z, a33 * cos * -zOrigin + zOrigin);\n }\n\n if (transformPerspective !== _zeroPx) {\n transforms += \"perspective(\" + transformPerspective + _endParenthesis;\n }\n\n if (xPercent || yPercent) {\n transforms += \"translate(\" + xPercent + \"%, \" + yPercent + \"%) \";\n }\n\n if (use3D || x !== _zeroPx || y !== _zeroPx || z !== _zeroPx) {\n transforms += z !== _zeroPx || use3D ? \"translate3d(\" + x + \", \" + y + \", \" + z + \") \" : \"translate(\" + x + \", \" + y + _endParenthesis;\n }\n\n if (rotation !== _zeroDeg) {\n transforms += \"rotate(\" + rotation + _endParenthesis;\n }\n\n if (rotationY !== _zeroDeg) {\n transforms += \"rotateY(\" + rotationY + _endParenthesis;\n }\n\n if (rotationX !== _zeroDeg) {\n transforms += \"rotateX(\" + rotationX + _endParenthesis;\n }\n\n if (skewX !== _zeroDeg || skewY !== _zeroDeg) {\n transforms += \"skew(\" + skewX + \", \" + skewY + _endParenthesis;\n }\n\n if (scaleX !== 1 || scaleY !== 1) {\n transforms += \"scale(\" + scaleX + \", \" + scaleY + _endParenthesis;\n }\n\n target.style[_transformProp] = transforms || \"translate(0, 0)\";\n},\n _renderSVGTransforms = function _renderSVGTransforms(ratio, cache) {\n var _ref2 = cache || this,\n xPercent = _ref2.xPercent,\n yPercent = _ref2.yPercent,\n x = _ref2.x,\n y = _ref2.y,\n rotation = _ref2.rotation,\n skewX = _ref2.skewX,\n skewY = _ref2.skewY,\n scaleX = _ref2.scaleX,\n scaleY = _ref2.scaleY,\n target = _ref2.target,\n xOrigin = _ref2.xOrigin,\n yOrigin = _ref2.yOrigin,\n xOffset = _ref2.xOffset,\n yOffset = _ref2.yOffset,\n forceCSS = _ref2.forceCSS,\n tx = parseFloat(x),\n ty = parseFloat(y),\n a11,\n a21,\n a12,\n a22,\n temp;\n\n rotation = parseFloat(rotation);\n skewX = parseFloat(skewX);\n skewY = parseFloat(skewY);\n\n if (skewY) {\n //for performance reasons, we combine all skewing into the skewX and rotation values. Remember, a skewY of 10 degrees looks the same as a rotation of 10 degrees plus a skewX of 10 degrees.\n skewY = parseFloat(skewY);\n skewX += skewY;\n rotation += skewY;\n }\n\n if (rotation || skewX) {\n rotation *= _DEG2RAD;\n skewX *= _DEG2RAD;\n a11 = Math.cos(rotation) * scaleX;\n a21 = Math.sin(rotation) * scaleX;\n a12 = Math.sin(rotation - skewX) * -scaleY;\n a22 = Math.cos(rotation - skewX) * scaleY;\n\n if (skewX) {\n skewY *= _DEG2RAD;\n temp = Math.tan(skewX - skewY);\n temp = Math.sqrt(1 + temp * temp);\n a12 *= temp;\n a22 *= temp;\n\n if (skewY) {\n temp = Math.tan(skewY);\n temp = Math.sqrt(1 + temp * temp);\n a11 *= temp;\n a21 *= temp;\n }\n }\n\n a11 = _round(a11);\n a21 = _round(a21);\n a12 = _round(a12);\n a22 = _round(a22);\n } else {\n a11 = scaleX;\n a22 = scaleY;\n a21 = a12 = 0;\n }\n\n if (tx && !~(x + \"\").indexOf(\"px\") || ty && !~(y + \"\").indexOf(\"px\")) {\n tx = _convertToUnit(target, \"x\", x, \"px\");\n ty = _convertToUnit(target, \"y\", y, \"px\");\n }\n\n if (xOrigin || yOrigin || xOffset || yOffset) {\n tx = _round(tx + xOrigin - (xOrigin * a11 + yOrigin * a12) + xOffset);\n ty = _round(ty + yOrigin - (xOrigin * a21 + yOrigin * a22) + yOffset);\n }\n\n if (xPercent || yPercent) {\n //The SVG spec doesn't support percentage-based translation in the \"transform\" attribute, so we merge it into the translation to simulate it.\n temp = target.getBBox();\n tx = _round(tx + xPercent / 100 * temp.width);\n ty = _round(ty + yPercent / 100 * temp.height);\n }\n\n temp = \"matrix(\" + a11 + \",\" + a21 + \",\" + a12 + \",\" + a22 + \",\" + tx + \",\" + ty + \")\";\n target.setAttribute(\"transform\", temp);\n forceCSS && (target.style[_transformProp] = temp); //some browsers prioritize CSS transforms over the transform attribute. When we sense that the user has CSS transforms applied, we must overwrite them this way (otherwise some browser simply won't render the transform attribute changes!)\n},\n _addRotationalPropTween = function _addRotationalPropTween(plugin, target, property, startNum, endValue) {\n var cap = 360,\n isString = _isString(endValue),\n endNum = parseFloat(endValue) * (isString && ~endValue.indexOf(\"rad\") ? _RAD2DEG : 1),\n change = endNum - startNum,\n finalValue = startNum + change + \"deg\",\n direction,\n pt;\n\n if (isString) {\n direction = endValue.split(\"_\")[1];\n\n if (direction === \"short\") {\n change %= cap;\n\n if (change !== change % (cap / 2)) {\n change += change < 0 ? cap : -cap;\n }\n }\n\n if (direction === \"cw\" && change < 0) {\n change = (change + cap * _bigNum) % cap - ~~(change / cap) * cap;\n } else if (direction === \"ccw\" && change > 0) {\n change = (change - cap * _bigNum) % cap - ~~(change / cap) * cap;\n }\n }\n\n plugin._pt = pt = new PropTween(plugin._pt, target, property, startNum, change, _renderPropWithEnd);\n pt.e = finalValue;\n pt.u = \"deg\";\n\n plugin._props.push(property);\n\n return pt;\n},\n _assign = function _assign(target, source) {\n // Internet Explorer doesn't have Object.assign(), so we recreate it here.\n for (var p in source) {\n target[p] = source[p];\n }\n\n return target;\n},\n _addRawTransformPTs = function _addRawTransformPTs(plugin, transforms, target) {\n //for handling cases where someone passes in a whole transform string, like transform: \"scale(2, 3) rotate(20deg) translateY(30em)\"\n var startCache = _assign({}, target._gsap),\n exclude = \"perspective,force3D,transformOrigin,svgOrigin\",\n style = target.style,\n endCache,\n p,\n startValue,\n endValue,\n startNum,\n endNum,\n startUnit,\n endUnit;\n\n if (startCache.svg) {\n startValue = target.getAttribute(\"transform\");\n target.setAttribute(\"transform\", \"\");\n style[_transformProp] = transforms;\n endCache = _parseTransform(target, 1);\n\n _removeProperty(target, _transformProp);\n\n target.setAttribute(\"transform\", startValue);\n } else {\n startValue = getComputedStyle(target)[_transformProp];\n style[_transformProp] = transforms;\n endCache = _parseTransform(target, 1);\n style[_transformProp] = startValue;\n }\n\n for (p in _transformProps) {\n startValue = startCache[p];\n endValue = endCache[p];\n\n if (startValue !== endValue && exclude.indexOf(p) < 0) {\n //tweening to no perspective gives very unintuitive results - just keep the same perspective in that case.\n startUnit = getUnit(startValue);\n endUnit = getUnit(endValue);\n startNum = startUnit !== endUnit ? _convertToUnit(target, p, startValue, endUnit) : parseFloat(startValue);\n endNum = parseFloat(endValue);\n plugin._pt = new PropTween(plugin._pt, endCache, p, startNum, endNum - startNum, _renderCSSProp);\n plugin._pt.u = endUnit || 0;\n\n plugin._props.push(p);\n }\n }\n\n _assign(endCache, startCache);\n}; // handle splitting apart padding, margin, borderWidth, and borderRadius into their 4 components. Firefox, for example, won't report borderRadius correctly - it will only do borderTopLeftRadius and the other corners. We also want to handle paddingTop, marginLeft, borderRightWidth, etc.\n\n\n_forEachName(\"padding,margin,Width,Radius\", function (name, index) {\n var t = \"Top\",\n r = \"Right\",\n b = \"Bottom\",\n l = \"Left\",\n props = (index < 3 ? [t, r, b, l] : [t + l, t + r, b + r, b + l]).map(function (side) {\n return index < 2 ? name + side : \"border\" + side + name;\n });\n\n _specialProps[index > 1 ? \"border\" + name : name] = function (plugin, target, property, endValue, tween) {\n var a, vars;\n\n if (arguments.length < 4) {\n // getter, passed target, property, and unit (from _get())\n a = props.map(function (prop) {\n return _get(plugin, prop, property);\n });\n vars = a.join(\" \");\n return vars.split(a[0]).length === 5 ? a[0] : vars;\n }\n\n a = (endValue + \"\").split(\" \");\n vars = {};\n props.forEach(function (prop, i) {\n return vars[prop] = a[i] = a[i] || a[(i - 1) / 2 | 0];\n });\n plugin.init(target, vars, tween);\n };\n});\n\nexport var CSSPlugin = {\n name: \"css\",\n register: _initCore,\n targetTest: function targetTest(target) {\n return target.style && target.nodeType;\n },\n init: function init(target, vars, tween, index, targets) {\n var props = this._props,\n style = target.style,\n startAt = tween.vars.startAt,\n startValue,\n endValue,\n endNum,\n startNum,\n type,\n specialProp,\n p,\n startUnit,\n endUnit,\n relative,\n isTransformRelated,\n transformPropTween,\n cache,\n smooth,\n hasPriority,\n inlineProps;\n _pluginInitted || _initCore(); // we may call init() multiple times on the same plugin instance, like when adding special properties, so make sure we don't overwrite the revert data or inlineProps\n\n this.styles = this.styles || _getStyleSaver(target);\n inlineProps = this.styles.props;\n this.tween = tween;\n\n for (p in vars) {\n if (p === \"autoRound\") {\n continue;\n }\n\n endValue = vars[p];\n\n if (_plugins[p] && _checkPlugin(p, vars, tween, index, target, targets)) {\n // plugins\n continue;\n }\n\n type = typeof endValue;\n specialProp = _specialProps[p];\n\n if (type === \"function\") {\n endValue = endValue.call(tween, index, target, targets);\n type = typeof endValue;\n }\n\n if (type === \"string\" && ~endValue.indexOf(\"random(\")) {\n endValue = _replaceRandom(endValue);\n }\n\n if (specialProp) {\n specialProp(this, target, p, endValue, tween) && (hasPriority = 1);\n } else if (p.substr(0, 2) === \"--\") {\n //CSS variable\n startValue = (getComputedStyle(target).getPropertyValue(p) + \"\").trim();\n endValue += \"\";\n _colorExp.lastIndex = 0;\n\n if (!_colorExp.test(startValue)) {\n // colors don't have units\n startUnit = getUnit(startValue);\n endUnit = getUnit(endValue);\n }\n\n endUnit ? startUnit !== endUnit && (startValue = _convertToUnit(target, p, startValue, endUnit) + endUnit) : startUnit && (endValue += startUnit);\n this.add(style, \"setProperty\", startValue, endValue, index, targets, 0, 0, p);\n props.push(p);\n inlineProps.push(p, 0, style[p]);\n } else if (type !== \"undefined\") {\n if (startAt && p in startAt) {\n // in case someone hard-codes a complex value as the start, like top: \"calc(2vh / 2)\". Without this, it'd use the computed value (always in px)\n startValue = typeof startAt[p] === \"function\" ? startAt[p].call(tween, index, target, targets) : startAt[p];\n _isString(startValue) && ~startValue.indexOf(\"random(\") && (startValue = _replaceRandom(startValue));\n getUnit(startValue + \"\") || startValue === \"auto\" || (startValue += _config.units[p] || getUnit(_get(target, p)) || \"\"); // for cases when someone passes in a unitless value like {x: 100}; if we try setting translate(100, 0px) it won't work.\n\n (startValue + \"\").charAt(1) === \"=\" && (startValue = _get(target, p)); // can't work with relative values\n } else {\n startValue = _get(target, p);\n }\n\n startNum = parseFloat(startValue);\n relative = type === \"string\" && endValue.charAt(1) === \"=\" && endValue.substr(0, 2);\n relative && (endValue = endValue.substr(2));\n endNum = parseFloat(endValue);\n\n if (p in _propertyAliases) {\n if (p === \"autoAlpha\") {\n //special case where we control the visibility along with opacity. We still allow the opacity value to pass through and get tweened.\n if (startNum === 1 && _get(target, \"visibility\") === \"hidden\" && endNum) {\n //if visibility is initially set to \"hidden\", we should interpret that as intent to make opacity 0 (a convenience)\n startNum = 0;\n }\n\n inlineProps.push(\"visibility\", 0, style.visibility);\n\n _addNonTweeningPT(this, style, \"visibility\", startNum ? \"inherit\" : \"hidden\", endNum ? \"inherit\" : \"hidden\", !endNum);\n }\n\n if (p !== \"scale\" && p !== \"transform\") {\n p = _propertyAliases[p];\n ~p.indexOf(\",\") && (p = p.split(\",\")[0]);\n }\n }\n\n isTransformRelated = p in _transformProps; //--- TRANSFORM-RELATED ---\n\n if (isTransformRelated) {\n this.styles.save(p);\n\n if (!transformPropTween) {\n cache = target._gsap;\n cache.renderTransform && !vars.parseTransform || _parseTransform(target, vars.parseTransform); // if, for example, gsap.set(... {transform:\"translateX(50vw)\"}), the _get() call doesn't parse the transform, thus cache.renderTransform won't be set yet so force the parsing of the transform here.\n\n smooth = vars.smoothOrigin !== false && cache.smooth;\n transformPropTween = this._pt = new PropTween(this._pt, style, _transformProp, 0, 1, cache.renderTransform, cache, 0, -1); //the first time through, create the rendering PropTween so that it runs LAST (in the linked list, we keep adding to the beginning)\n\n transformPropTween.dep = 1; //flag it as dependent so that if things get killed/overwritten and this is the only PropTween left, we can safely kill the whole tween.\n }\n\n if (p === \"scale\") {\n this._pt = new PropTween(this._pt, cache, \"scaleY\", cache.scaleY, (relative ? _parseRelative(cache.scaleY, relative + endNum) : endNum) - cache.scaleY || 0, _renderCSSProp);\n this._pt.u = 0;\n props.push(\"scaleY\", p);\n p += \"X\";\n } else if (p === \"transformOrigin\") {\n inlineProps.push(_transformOriginProp, 0, style[_transformOriginProp]);\n endValue = _convertKeywordsToPercentages(endValue); //in case something like \"left top\" or \"bottom right\" is passed in. Convert to percentages.\n\n if (cache.svg) {\n _applySVGOrigin(target, endValue, 0, smooth, 0, this);\n } else {\n endUnit = parseFloat(endValue.split(\" \")[2]) || 0; //handle the zOrigin separately!\n\n endUnit !== cache.zOrigin && _addNonTweeningPT(this, cache, \"zOrigin\", cache.zOrigin, endUnit);\n\n _addNonTweeningPT(this, style, p, _firstTwoOnly(startValue), _firstTwoOnly(endValue));\n }\n\n continue;\n } else if (p === \"svgOrigin\") {\n _applySVGOrigin(target, endValue, 1, smooth, 0, this);\n\n continue;\n } else if (p in _rotationalProperties) {\n _addRotationalPropTween(this, cache, p, startNum, relative ? _parseRelative(startNum, relative + endValue) : endValue);\n\n continue;\n } else if (p === \"smoothOrigin\") {\n _addNonTweeningPT(this, cache, \"smooth\", cache.smooth, endValue);\n\n continue;\n } else if (p === \"force3D\") {\n cache[p] = endValue;\n continue;\n } else if (p === \"transform\") {\n _addRawTransformPTs(this, endValue, target);\n\n continue;\n }\n } else if (!(p in style)) {\n p = _checkPropPrefix(p) || p;\n }\n\n if (isTransformRelated || (endNum || endNum === 0) && (startNum || startNum === 0) && !_complexExp.test(endValue) && p in style) {\n startUnit = (startValue + \"\").substr((startNum + \"\").length);\n endNum || (endNum = 0); // protect against NaN\n\n endUnit = getUnit(endValue) || (p in _config.units ? _config.units[p] : startUnit);\n startUnit !== endUnit && (startNum = _convertToUnit(target, p, startValue, endUnit));\n this._pt = new PropTween(this._pt, isTransformRelated ? cache : style, p, startNum, (relative ? _parseRelative(startNum, relative + endNum) : endNum) - startNum, !isTransformRelated && (endUnit === \"px\" || p === \"zIndex\") && vars.autoRound !== false ? _renderRoundedCSSProp : _renderCSSProp);\n this._pt.u = endUnit || 0;\n\n if (startUnit !== endUnit && endUnit !== \"%\") {\n //when the tween goes all the way back to the beginning, we need to revert it to the OLD/ORIGINAL value (with those units). We record that as a \"b\" (beginning) property and point to a render method that handles that. (performance optimization)\n this._pt.b = startValue;\n this._pt.r = _renderCSSPropWithBeginning;\n }\n } else if (!(p in style)) {\n if (p in target) {\n //maybe it's not a style - it could be a property added directly to an element in which case we'll try to animate that.\n this.add(target, p, startValue || target[p], relative ? relative + endValue : endValue, index, targets);\n } else if (p !== \"parseTransform\") {\n _missingPlugin(p, endValue);\n\n continue;\n }\n } else {\n _tweenComplexCSSString.call(this, target, p, startValue, relative ? relative + endValue : endValue);\n }\n\n isTransformRelated || (p in style ? inlineProps.push(p, 0, style[p]) : inlineProps.push(p, 1, startValue || target[p]));\n props.push(p);\n }\n }\n\n hasPriority && _sortPropTweensByPriority(this);\n },\n render: function render(ratio, data) {\n if (data.tween._time || !_reverting()) {\n var pt = data._pt;\n\n while (pt) {\n pt.r(ratio, pt.d);\n pt = pt._next;\n }\n } else {\n data.styles.revert();\n }\n },\n get: _get,\n aliases: _propertyAliases,\n getSetter: function getSetter(target, property, plugin) {\n //returns a setter function that accepts target, property, value and applies it accordingly. Remember, properties like \"x\" aren't as simple as target.style.property = value because they've got to be applied to a proxy object and then merged into a transform string in a renderer.\n var p = _propertyAliases[property];\n p && p.indexOf(\",\") < 0 && (property = p);\n return property in _transformProps && property !== _transformOriginProp && (target._gsap.x || _get(target, \"x\")) ? plugin && _recentSetterPlugin === plugin ? property === \"scale\" ? _setterScale : _setterTransform : (_recentSetterPlugin = plugin || {}) && (property === \"scale\" ? _setterScaleWithRender : _setterTransformWithRender) : target.style && !_isUndefined(target.style[property]) ? _setterCSSStyle : ~property.indexOf(\"-\") ? _setterCSSProp : _getSetter(target, property);\n },\n core: {\n _removeProperty: _removeProperty,\n _getMatrix: _getMatrix\n }\n};\ngsap.utils.checkPrefix = _checkPropPrefix;\ngsap.core.getStyleSaver = _getStyleSaver;\n\n(function (positionAndScale, rotation, others, aliases) {\n var all = _forEachName(positionAndScale + \",\" + rotation + \",\" + others, function (name) {\n _transformProps[name] = 1;\n });\n\n _forEachName(rotation, function (name) {\n _config.units[name] = \"deg\";\n _rotationalProperties[name] = 1;\n });\n\n _propertyAliases[all[13]] = positionAndScale + \",\" + rotation;\n\n _forEachName(aliases, function (name) {\n var split = name.split(\":\");\n _propertyAliases[split[1]] = all[split[0]];\n });\n})(\"x,y,z,scale,scaleX,scaleY,xPercent,yPercent\", \"rotation,rotationX,rotationY,skewX,skewY\", \"transform,transformOrigin,svgOrigin,force3D,smoothOrigin,transformPerspective\", \"0:translateX,1:translateY,2:translateZ,8:rotate,8:rotationZ,8:rotateZ,9:rotateX,10:rotateY\");\n\n_forEachName(\"x,y,z,top,right,bottom,left,width,height,fontSize,padding,margin,perspective\", function (name) {\n _config.units[name] = \"px\";\n});\n\ngsap.registerPlugin(CSSPlugin);\nexport { CSSPlugin as default, _getBBox, _createElement, _checkPropPrefix as checkPrefix };","import { gsap, Power0, Power1, Power2, Power3, Power4, Linear, Quad, Cubic, Quart, Quint, Strong, Elastic, Back, SteppedEase, Bounce, Sine, Expo, Circ, TweenLite, TimelineLite, TimelineMax } from \"./gsap-core.js\";\nimport { CSSPlugin } from \"./CSSPlugin.js\";\nvar gsapWithCSS = gsap.registerPlugin(CSSPlugin) || gsap,\n // to protect from tree shaking\nTweenMaxWithCSS = gsapWithCSS.core.Tween;\nexport { gsapWithCSS as gsap, gsapWithCSS as default, CSSPlugin, TweenMaxWithCSS as TweenMax, TweenLite, TimelineMax, TimelineLite, Power0, Power1, Power2, Power3, Power4, Linear, Quad, Cubic, Quart, Quint, Strong, Elastic, Back, SteppedEase, Bounce, Sine, Expo, Circ };","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","import AccordionItem from './accordion-item/accordion-item.vue'\r\nimport Breadcrumb from './breadcrumb/breadcrumb.vue'\r\nimport Button from './button/button.vue'\r\nimport CategoryTag from './category-tag/category-tag.vue'\r\nimport CopyToClipboard from './copy-to-clipboard/copy-to-clipboard.vue'\r\nimport Col from './disposition/col.vue'\r\nimport Ct from './disposition/ct.vue'\r\nimport Row from './disposition/row.vue'\r\nimport Divider from './divider/divider.vue'\r\nimport Gradient from './gradient/gradient.vue'\r\nimport Image from './image/image.vue'\r\nimport Kicker from './kicker/kicker.vue'\r\nimport LinkItem from './link-item/link-item.vue'\r\nimport NtLoading from './nt-loading/nt-loading.vue'\r\nimport Overlay from './overlay/overlay.vue'\r\nimport Player from './player/player.vue'\r\nimport ScrollToTop from './scroll-to-top/scroll-to-top.vue'\r\nimport SocialIcons from './social-media-icons/social-media-icons.vue'\r\nimport Text from './text/text.vue'\r\nimport Title from './title/title.vue'\r\nimport Topic from './topic/topic.vue'\r\nimport TextWithIcon from './text-with-icon/text-with-icon.vue'\r\n\r\nexport default [\r\n AccordionItem,\r\n Breadcrumb,\r\n Button,\r\n CategoryTag,\r\n CopyToClipboard,\r\n Col,\r\n Ct,\r\n Row,\r\n Divider,\r\n Gradient,\r\n Image,\r\n Kicker,\r\n LinkItem,\r\n NtLoading,\r\n Overlay,\r\n Player,\r\n ScrollToTop,\r\n SocialIcons,\r\n Text,\r\n Title,\r\n Topic,\r\n TextWithIcon\r\n]\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n","import Axios from 'axios'\r\n\r\nconst API = {\r\n options: {\r\n search: '/api/sitecore/press/search'\r\n },\r\n search(data) {\r\n return Axios.post(this.options.search, data).then((response) => {\r\n return response.data\r\n }).catch((error) => {\r\n console.error('API.search()', error)\r\n })\r\n }\r\n}\r\n\r\nexport default API\r\n","\r\n\r\n\r\n","import Store from '../../../store'\r\nimport Press from './press.vue'\r\nimport API from './api'\r\n\r\nStore.registerModule('press', {\r\n namespaced: true,\r\n state: {\r\n query: '',\r\n category: '',\r\n total: 0,\r\n current: 1,\r\n results: [],\r\n numberOfResults: 0\r\n },\r\n mutations: {\r\n filter(state, request) {\r\n API.search({\r\n SearchTerm: request.query || '',\r\n CurrentPage: 1,\r\n Categories: request.category ? [request.category] : [],\r\n }).then(data => Object.assign(state, {\r\n query: request.query,\r\n total: data.NumberOfPages,\r\n current: 1,\r\n category: request.category,\r\n results: data.results,\r\n numberOfResults: data.NumberOfResults\r\n }))\r\n },\r\n paginate(state, current) {\r\n API.search({\r\n SearchTerm: state.query,\r\n CurrentPage: current,\r\n Categories: [state.category],\r\n }).then(data => Object.assign(state, {\r\n current,\r\n results: data.results,\r\n numberOfResults: data.NumberOfResults\r\n }))\r\n }\r\n }\r\n})\r\nexport default Press\r\n","\r\n\r\n\r\n\r\n","\r\n\r\n\r\n","\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","import Accordion from './accordion/accordion.vue'\r\nimport CardNews from './card-news/card-news.vue'\r\nimport Heading from './heading/heading.vue'\r\nimport HeadquarterItem from './headquarter-item/headquarter-item.vue'\r\nimport LinkList from './link-list/link-list.vue'\r\nimport NtDropDown from './nt-dropdown/nt-dropdown.vue'\r\nimport NtCheck from './nt-form-fields/nt-form-checkgroup/form-check.vue'\r\nimport NtFormCheckGroup from './nt-form-fields/nt-form-checkgroup/nt-form-checkgroup.vue'\r\nimport NtFormCheckLink from './nt-form-fields/nt-form-checklink/nt-form-checklink.vue'\r\nimport NtFormCustomResult from './nt-form-fields/nt-form-customresult/nt-form-customresult.vue'\r\nimport NtFormInput from './nt-form-fields/nt-form-input/nt-form-input.vue'\r\nimport NtFormRadio from './nt-form-fields/nt-form-radiogroup/nt-form-radio.vue'\r\nimport NtFormRadioGroup from './nt-form-fields/nt-form-radiogroup/nt-form-radiogroup.vue'\r\nimport NtFormRichText from './nt-form-fields/nt-form-richtext/nt-form-richtext.vue'\r\nimport NtFormSelect from './nt-form-fields/nt-form-select-2/nt-form-select-2.vue'\r\nimport NtFormSubmit from './nt-form-fields/nt-form-submit/nt-form-submit.vue'\r\nimport NtFormTextarea from './nt-form-fields/nt-form-textarea/form-textarea.vue'\r\nimport NtFile from './nt-form-fields/nt-form-uploader/uploader-file.vue'\r\nimport NtUploader from './nt-form-fields/nt-form-uploader/uploader.vue'\r\nimport NtQuote from './nt-quote/nt-quote.vue'\r\nimport Onetrust from './onetrust/onetrust.vue'\r\nimport OnetrustBlocker from './onetrust/onetrust-blocker.vue'\r\nimport Paginator from './paginator/paginator.vue'\r\nimport Press from './press'\r\nimport SafetyDataSheet from './safety-datasheet-v2/safety-datasheet-v2.vue'\r\nimport SearchInput from './search-input/search-input.vue'\r\nimport ShareOverlay from './share-overlay/share-overlay.vue'\r\nimport ShareThis from './share-this/share-this.vue'\r\nimport SmartCard from './smart-card/smart-card.vue'\r\n\r\nexport default [\r\n Accordion,\r\n CardNews,\r\n Heading,\r\n HeadquarterItem,\r\n LinkList,\r\n NtDropDown,\r\n NtCheck,\r\n NtFormCheckGroup,\r\n NtFormCheckLink,\r\n NtFormCustomResult,\r\n NtFormInput,\r\n NtFormRadio,\r\n NtFormRadioGroup,\r\n NtFormRichText,\r\n NtFormSelect,\r\n NtFormSubmit,\r\n NtFormTextarea,\r\n NtFile,\r\n NtUploader,\r\n NtQuote,\r\n Onetrust,\r\n OnetrustBlocker,\r\n Paginator,\r\n Press,\r\n SafetyDataSheet,\r\n SearchInput,\r\n ShareOverlay,\r\n ShareThis,\r\n SmartCard\r\n]\r\n","\r\n\r\n\r\n","\r\n\r\n\r\n","import Axios from 'axios'\r\n\r\nconst API = {\r\n options: {\r\n search: ''\r\n },\r\n search(data) {\r\n return (window.location.hostname === 'localhost' ? Axios.get(this.options.search, data) : Axios.post(this.options.search, data)).then((response) => {\r\n return response.data\r\n }).catch((error) => {\r\n console.error('API.search()', error)\r\n })\r\n }\r\n}\r\n\r\nexport default API\r\n","var root = require('./_root');\n\n/** Used to detect overreaching core-js shims. */\nvar coreJsData = root['__core-js_shared__'];\n\nmodule.exports = coreJsData;\n","var coreJsData = require('./_coreJsData');\n\n/** Used to detect methods masquerading as native. */\nvar maskSrcKey = (function() {\n var uid = /[^.]+$/.exec(coreJsData && coreJsData.keys && coreJsData.keys.IE_PROTO || '');\n return uid ? ('Symbol(src)_1.' + uid) : '';\n}());\n\n/**\n * Checks if `func` has its source masked.\n *\n * @private\n * @param {Function} func The function to check.\n * @returns {boolean} Returns `true` if `func` is masked, else `false`.\n */\nfunction isMasked(func) {\n return !!maskSrcKey && (maskSrcKey in func);\n}\n\nmodule.exports = isMasked;\n","/** Used for built-in method references. */\nvar funcProto = Function.prototype;\n\n/** Used to resolve the decompiled source of functions. */\nvar funcToString = funcProto.toString;\n\n/**\n * Converts `func` to its source code.\n *\n * @private\n * @param {Function} func The function to convert.\n * @returns {string} Returns the source code.\n */\nfunction toSource(func) {\n if (func != null) {\n try {\n return funcToString.call(func);\n } catch (e) {}\n try {\n return (func + '');\n } catch (e) {}\n }\n return '';\n}\n\nmodule.exports = toSource;\n","var isFunction = require('./isFunction'),\n isMasked = require('./_isMasked'),\n isObject = require('./isObject'),\n toSource = require('./_toSource');\n\n/**\n * Used to match `RegExp`\n * [syntax characters](http://ecma-international.org/ecma-262/7.0/#sec-patterns).\n */\nvar reRegExpChar = /[\\\\^$.*+?()[\\]{}|]/g;\n\n/** Used to detect host constructors (Safari). */\nvar reIsHostCtor = /^\\[object .+?Constructor\\]$/;\n\n/** Used for built-in method references. */\nvar funcProto = Function.prototype,\n objectProto = Object.prototype;\n\n/** Used to resolve the decompiled source of functions. */\nvar funcToString = funcProto.toString;\n\n/** Used to check objects for own properties. */\nvar hasOwnProperty = objectProto.hasOwnProperty;\n\n/** Used to detect if a method is native. */\nvar reIsNative = RegExp('^' +\n funcToString.call(hasOwnProperty).replace(reRegExpChar, '\\\\$&')\n .replace(/hasOwnProperty|(function).*?(?=\\\\\\()| for .+?(?=\\\\\\])/g, '$1.*?') + '$'\n);\n\n/**\n * The base implementation of `_.isNative` without bad shim checks.\n *\n * @private\n * @param {*} value The value to check.\n * @returns {boolean} Returns `true` if `value` is a native function,\n * else `false`.\n */\nfunction baseIsNative(value) {\n if (!isObject(value) || isMasked(value)) {\n return false;\n }\n var pattern = isFunction(value) ? reIsNative : reIsHostCtor;\n return pattern.test(toSource(value));\n}\n\nmodule.exports = baseIsNative;\n","/**\n * Gets the value at `key` of `object`.\n *\n * @private\n * @param {Object} [object] The object to query.\n * @param {string} key The key of the property to get.\n * @returns {*} Returns the property value.\n */\nfunction getValue(object, key) {\n return object == null ? undefined : object[key];\n}\n\nmodule.exports = getValue;\n","var baseIsNative = require('./_baseIsNative'),\n getValue = require('./_getValue');\n\n/**\n * Gets the native function at `key` of `object`.\n *\n * @private\n * @param {Object} object The object to query.\n * @param {string} key The key of the method to get.\n * @returns {*} Returns the function if it's native, else `undefined`.\n */\nfunction getNative(object, key) {\n var value = getValue(object, key);\n return baseIsNative(value) ? value : undefined;\n}\n\nmodule.exports = getNative;\n","var getNative = require('./_getNative'),\n root = require('./_root');\n\n/* Built-in method references that are verified to be native. */\nvar DataView = getNative(root, 'DataView');\n\nmodule.exports = DataView;\n","var getNative = require('./_getNative'),\n root = require('./_root');\n\n/* Built-in method references that are verified to be native. */\nvar Map = getNative(root, 'Map');\n\nmodule.exports = Map;\n","var getNative = require('./_getNative'),\n root = require('./_root');\n\n/* Built-in method references that are verified to be native. */\nvar Promise = getNative(root, 'Promise');\n\nmodule.exports = Promise;\n","var getNative = require('./_getNative'),\n root = require('./_root');\n\n/* Built-in method references that are verified to be native. */\nvar Set = getNative(root, 'Set');\n\nmodule.exports = Set;\n","var getNative = require('./_getNative'),\n root = require('./_root');\n\n/* Built-in method references that are verified to be native. */\nvar WeakMap = getNative(root, 'WeakMap');\n\nmodule.exports = WeakMap;\n","var DataView = require('./_DataView'),\n Map = require('./_Map'),\n Promise = require('./_Promise'),\n Set = require('./_Set'),\n WeakMap = require('./_WeakMap'),\n baseGetTag = require('./_baseGetTag'),\n toSource = require('./_toSource');\n\n/** `Object#toString` result references. */\nvar mapTag = '[object Map]',\n objectTag = '[object Object]',\n promiseTag = '[object Promise]',\n setTag = '[object Set]',\n weakMapTag = '[object WeakMap]';\n\nvar dataViewTag = '[object DataView]';\n\n/** Used to detect maps, sets, and weakmaps. */\nvar dataViewCtorString = toSource(DataView),\n mapCtorString = toSource(Map),\n promiseCtorString = toSource(Promise),\n setCtorString = toSource(Set),\n weakMapCtorString = toSource(WeakMap);\n\n/**\n * Gets the `toStringTag` of `value`.\n *\n * @private\n * @param {*} value The value to query.\n * @returns {string} Returns the `toStringTag`.\n */\nvar getTag = baseGetTag;\n\n// Fallback for data views, maps, sets, and weak maps in IE 11 and promises in Node.js < 6.\nif ((DataView && getTag(new DataView(new ArrayBuffer(1))) != dataViewTag) ||\n (Map && getTag(new Map) != mapTag) ||\n (Promise && getTag(Promise.resolve()) != promiseTag) ||\n (Set && getTag(new Set) != setTag) ||\n (WeakMap && getTag(new WeakMap) != weakMapTag)) {\n getTag = function(value) {\n var result = baseGetTag(value),\n Ctor = result == objectTag ? value.constructor : undefined,\n ctorString = Ctor ? toSource(Ctor) : '';\n\n if (ctorString) {\n switch (ctorString) {\n case dataViewCtorString: return dataViewTag;\n case mapCtorString: return mapTag;\n case promiseCtorString: return promiseTag;\n case setCtorString: return setTag;\n case weakMapCtorString: return weakMapTag;\n }\n }\n return result;\n };\n}\n\nmodule.exports = getTag;\n","var baseKeys = require('./_baseKeys'),\n getTag = require('./_getTag'),\n isArguments = require('./isArguments'),\n isArray = require('./isArray'),\n isArrayLike = require('./isArrayLike'),\n isBuffer = require('./isBuffer'),\n isPrototype = require('./_isPrototype'),\n isTypedArray = require('./isTypedArray');\n\n/** `Object#toString` result references. */\nvar mapTag = '[object Map]',\n setTag = '[object Set]';\n\n/** Used for built-in method references. */\nvar objectProto = Object.prototype;\n\n/** Used to check objects for own properties. */\nvar hasOwnProperty = objectProto.hasOwnProperty;\n\n/**\n * Checks if `value` is an empty object, collection, map, or set.\n *\n * Objects are considered empty if they have no own enumerable string keyed\n * properties.\n *\n * Array-like values such as `arguments` objects, arrays, buffers, strings, or\n * jQuery-like collections are considered empty if they have a `length` of `0`.\n * Similarly, maps and sets are considered empty if they have a `size` of `0`.\n *\n * @static\n * @memberOf _\n * @since 0.1.0\n * @category Lang\n * @param {*} value The value to check.\n * @returns {boolean} Returns `true` if `value` is empty, else `false`.\n * @example\n *\n * _.isEmpty(null);\n * // => true\n *\n * _.isEmpty(true);\n * // => true\n *\n * _.isEmpty(1);\n * // => true\n *\n * _.isEmpty([1, 2, 3]);\n * // => false\n *\n * _.isEmpty({ 'a': 1 });\n * // => false\n */\nfunction isEmpty(value) {\n if (value == null) {\n return true;\n }\n if (isArrayLike(value) &&\n (isArray(value) || typeof value == 'string' || typeof value.splice == 'function' ||\n isBuffer(value) || isTypedArray(value) || isArguments(value))) {\n return !value.length;\n }\n var tag = getTag(value);\n if (tag == mapTag || tag == setTag) {\n return !value.size;\n }\n if (isPrototype(value)) {\n return !baseKeys(value).length;\n }\n for (var key in value) {\n if (hasOwnProperty.call(value, key)) {\n return false;\n }\n }\n return true;\n}\n\nmodule.exports = isEmpty;\n","export default \"data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAAa4AAAIMCAYAAACtyUjiAAAACXBIWXMAAAsTAAALEwEAmpwYAAAAAXNSR0IArs4c6QAAAARnQU1BAACxjwv8YQUAAFUoSURBVHgB7Z1fUhxHtv+zqgD73gcPs4Lb/QNNxDxd8SAkhR8MjxKSTa/AsALBCoAVgFYAWgGyZNC8SfdhQgY5At2niRiDu2cFl4mYiJGgq/KXp7oSVSdV2dXd9Sez+vuJmJHpQsg6zjrn5DmZ3+MwAACokDfv/9bg7swud1jjyr9qtR7+ucNAYdTB3g4DAIAKODw7m/26O/ss4MGG+HI29uhAONQdBLB8qZO9EbgAAKXz6tfzVS9wdsU/NlK+peM67sGje80dBsambvZG4AIAlMbrD78tedzb4owvxT8XX78T//cPx3F+VH5LRzzdWVmcP2BgaOpqbwQuAEDhUJnqq+7sFu+VqeJc8iDYefLgzh598epE7Ayc2zsDh7OXn4OrTZQPs1F3eyNwAQAK5c2H9lZCX4WJz3a6M1N7rYXmpfp7jt6frzHP2WK3S1vofw1gEuyNwAUAKAQqU7nc3WeKM6Qy1bXvrbceNju63//mfbvhu/42yofZmCR7I3ABAHIlPG7tfbWv9lUEncAP1p8+vPOODQE5VD4V7HLOVtWf53C++fj+/Es2wUyivRG4AAC5kLWvMiooH/YzyfZG4AIAjM1fTtvPfBZsM7Wvwvjz7rS3ndRXGZXXJ79tu477TP2zxGfbn6Yun7cWFnL7s0xl0u2NwAUAGJmor0Kn0u7GP6e+inPtba582/zICmBS+1+wdw8ELgDA0OTdVxn936PdCLzgLbtdzuqIctZyXcqHsHc/CFwAgMxoZIMuxWfP045bF01d+1+wdzIIXACATBydCmfFwsuqs8qjg6tpd7MKB6oS9WO21M+pH2ObfBTsnQ4CFwBAi042iPt8p6wyVVZs73/B3oNB4AIAJEJ9lcCboWx6TXnUsSEAHJ227zIWHLLb5ayPJo7zgL2zg8AFAOjD1L7KqJje/4K9hweBCwBwQ9r4i57oquirDJANMhUqZ3U9f8NlzjPlUccJ2PPHD+bGuqw7KrD3aCBwAQCs66uMiin9L9h7PHsjcAEwwRQtG2QqVZUPYe987I3ABcCEMsr4i7rx8y8XG47LqJzViH8uSnV7n4Or53kGMNg7P3sjcAEwYYw7/qJuFF0+hL37ycPeCFwATAimyAaZSuhQPX/fYc6S8qgTOMI+94YdDwJ76xjH3ghcANSc2HHrbeVReNz66f072wzcMG4/BvYejlHsjcAFQI0pc/xF3RhlnAfsPTrD2BuBC4AaMinHrYsmaz8G9s6HrPZG4AKgRqCvUgy6cR6iR9OBvfNl0PgUBC4AakKKmriVskGmounHSGDvHEmzNwIXADXh55PzA6XEIprb7s6kHbcumsOz9uzUVXcjYZwH7F0ASfZ2GQCgjtAI96UZz19iIGcumedO/SHhAexdCLftjcAFQA3xmf+c+XxHFFW2jk4v9g9F74uBsaFTgzPX37QjyaZ4KbADe+dP3N68l4yFIHABUFNWHs4frCzONUXP5R8z3sxbkhyCQx0NOjUoAlLbZ0GoJciDYJNz/lP8e2Dv/Eiyt+e7LfkcgQuAmkMXXl3fXfYDv0kOtXeIA2SBTmken/7+1uVueMKNdAWvpt2mTgwX9h6drPaeYgCA2vOod2BgLTpmfCiy2S127bdWvv3TRwZu0a9+wWO6gnOdLL8f9h6OYe2NwAXABBE51IXwmPG0Rw71nQlTgE0iVL+4DrYDFtC1go+BH2yOeh8L9h7MKPZGqRCACUTpx7SpH8MmHOqrUJkq3lcRNlrI4xIx7H2bceyNwAXABBP1Y5rUj6Fm+CT2Y6ivQicBqa9CChikKziojzUqsHc+9kapEIAJR/ZjXr//bcn13H2RBf/42f+8XvdyVqyvEg53LGs+Fuw9vr0RuAAAIVGJpkn9mN5puPr2Y179er7qXTu7oq/SYD1dwVbZuoKw9+j2RqkQANAH9WPoOLco4fyTHOrxLxcbrCbIvooXOIfiy1k6bk29pyrFcGHv4UHgAgDcgspZTxfnN0KH6vC7tvdjqEx1/KG9q/ZVTBnqCHsPB0qFAIBUZD9GqnQLh/qdbeUsedyas2DW9PlYsHc2ELgAAAOhcpb45YCm1EZyRgefup9emOxQqUwlMv59P+qr+Jyvf39//iWzANhbD0qFAIDM2CBnpMgGzUayQQu2BK04sHcy2HEBAIbCVDkjVTaI0XysaXeztTBn9UBH2Ps2CFwAgJEwSc4oLhtkeh9rVGDvL6BUCAAYiyrljBTZIJHp8/Uni/PLdQtacWBvBC4AQE6UKWekyAbdlX2VlcXwUMNEMMn2RqkQAJAbRcsZqbJBDmcvPweir5Jx3EjdmFR7I3ABAHKnCDmjuGxQXftYozJp9kapEABQGHnIGamyQTT+ou59rFGZFHsjcAEACmVUOaNbskEpY9xBP5Ngb5QKAQClMIyckSobpBvjDpKps70RuAAApaKTM1JkgzKNcQd66mhvlAoBAJWgyhnFZYOGGeMOslEne2PHBQCoDEXO6IzGX3SnvW3bZZpMpS72xo4LAFA5kUO9dKf+c7e10ETQKhjb7Y3ABQAAwCoQuAAARsAddsn+/a8/MlAKNtsbgQsAYAQu55eB68wyUAo22xuBCwAAgFUgcAEAALAKBC4AAABWgcAFAADAKhC4AAAAWAUCFwAAAKtA4AIAAGAVCFwAAACsAoELAACAVSBwAQAAsAoELgAAAFaBwAUAAMAqELgAAABYBQIXAAAAq0DgAgAAYBUIXAAAAKwCgQsAAIBVIHABAACwCgQuAAAAVoHABQAAwCqmGADAag7Pzma/7s4+C3jwg/zMY97+0enFd1f+1U7r4Z87DADLCbzrWVrZBHZcAFjMq1/PV2euvzkTQWtbfDmrPF6b8WbevvnQ3mIgNyhRIJs6jvND7OOGSBT2D9//rcFA7rz+8NuSCFqH8msELgAshF7k49Pf33qBQy9zQ/OtDQpqwqm2j07P1xgYCyQK5XL017/fpXXucvcti61zlAoBsAjK9r/qzm5xHmxwxuOPLnkQ7DjcuWSeQ46zofxW8bWzf3xy8cPn4GoT5cPhoETB494WD/iS8ugy+l8j+lomCmuM8Z2VxfkDBoZGs87FV/wddlwAWAJl8iLbb9PLHP9cOMqdq2m3+eTBnb2Vh/MHK4tzTR6wTfGoo/4M7rBVsStoo6yVDXKgxx/au5TxC4e5FH8WMP6c7J5i70aUKBzCzsPxl9P2s6R1znrJ2eaTxfllBC4ADIeyfSr1qeUpyjyvfLf59P6d7dZC8zL+e548mNtzfXeZc/4i5ceGZS2UD9NJSxRu7L44vyHtnmZvJArZkevcZ8EeU8qw8eSMvnYYAMBI3ghHx72v9tVMX9AJ/GD96cM777L9nHYj8ALqhd1N+ZaOw/nm4/vzL1mFHJ+ev/V9vpP171UU5EDFDmuf3S63ZrK7xt4dk8qHpthbs87DJOHa99ZbD5ud+OfocQFgGLK+H4SZ/u0+lsw6s/Ko99IvHL0Xu6uU/hd3nEOR7R5M8vH5GwfKb/exxH+L57SzzfJzNPZuUPlQ2HnLhEShamLXOLaVdU5okwSUCgEwiLT6vuynDBu04sj+F5VdUr6FyodtKpGRU2ETguxjBeLvntbHyhq04mjsLROFiS0fynUelb/jhH0ssptuJ4jABYABRPX9M7W+T6USdu0uxPsp40JOWPRjmmn9L3ImdOR7EvpfaYkC2V1k/Mt52F1j74lLFOQ1jsQ+1hDJGXpcAFRIXn2sUTk6bYs+TKC7C9YR5cPlMsqHZfZcoj7WLkvoQ/mijPd9QWU8jb07Zfe/yrR3uM7dmV06rKI+oyTBufY2V75tfsz689DjAqACYvV96mPFM8+wn9KdmdprLc7lssPSsbIYOoumrv8VnYqrRf9rUB8rtHtOO9skNPZuyP5XWYlCGfSv81sXtkdOzlAqBKBkqAQXq+/HX+YD2U8p0nkmQf0YOs6dpf/FLETKNIk+1lnC7lYEZVGOLdHuGns36nJ8PlrnSSojl9Hx9oVRd3soFQJQEjfqC4rjpFIJN+BYsoSOc/uuv+04zo8p39IpoqxVVOmq16tzqCzYl/GbYnedvV3H3X50r7nDCqAoe6et8whKzjbHTRAQuAAoGCpPiUyfdipryqOOybJAr07OVz0ndPiNlG/5KMparbzKWnk7Uo0DFU6Tb5pmd429OzYkCrSrFTss+vdfU5/lnSQgcAFQEJr6fin9lLzQ9L8kufS/8nKkmkTBCrtr7G1kojCoj1VE0EWPC4ACSFMRdzh7WXY/ZVxkP2aQfNTxLxcbrELifSymBK1IpskKu2vsfde0/hftagf1sYrY2WLHBUCO2NLHGhXqx/CpYJfz28eaIzqjZtjj7AAoUfCCxDLbx8APNm21u8beHSdgzx8/mBt45ymNcexN40ac6andpD4WJWefA9HHUmSa8gSBC4AciI9hUB6NJNNkOkWUD0dxpLo+Vp3srrF3p8xEQbPOS03OUCoEYEyyjBthNUORM+okfEt4fP745GK3iLJWlnEjdbK7xt6N6P5X4eXDLONGytrZInABMCKjjBupG5GcUWr/iztsI+/xKbpxI3nLY5mGxt6FJQppcmREVckZSoUADEnVMk2mkmV8SuAI+9xLts+g0tW440bqxrjjUwbZe5RxI2UByScAMqIZwzDU2Iu6kmV8CpX2hpWPyiTTVII8lmlkGZ+iSxTS0MiREUYkCdhxAZABqu+LUsk2S1C07k57tS8JjsLrk9+2XcdNlYgiVYhPU5fPWwsLoe3UHUB/onCLXBQY6oTG3omJQtKOK22dM8OSM/S4ANCQNoYhz7EXdWWc8Slp85qk3VcW59Zh937GGZ+SZdyISRUF7LgASAB9rHzJMj5FuCOR1fOfPMf5LsnuJstjmUaW8Sm04xIFbxHknO9YCTJNeYLABYBCiiirVTJNppLh/pcK7D4G+vtfDmk2Jh2kMT45Q+ACQOHnk/MDRambxl7sVHWCqm7Qabiu213T9b+IMhQYJoGs9mYWJQkIXAAoKIHrIwt3XihT5c3RX0U5azp4ywwdN1I3BoyrsSo5w+EMADT4zH/OhBMVOd5WHYb7mQIdvogFrb7s3mFOw/WcBgO58unry0vX9f4v4RElZ0sznr/ELAGBC4ABxOR2/kEqEOHpLASwkZBqI9HpNUZSQZzzn2Lf0kGikD9xuSbeC1Q32JicIXABkBEpt+MHfjNvGaO6Q6c06bg1XUAWXzZ0UkFIFPIjKVHwfLelfp9tNkfgAmAISK3gyf35NQpgIkN9Rk6BRjwwkEhsRlabjrgPo+OIRGF0hkkU4thic0g+ATACfXI7096hCGDv8pgCXCdCFYbrYDtgAfWxRpqLFdl5TerykYwRu/ZbK9/+6SMDt1Blyb5oCs51sv4MG2yOHRcAY6CUWEJ1AjbhKCoMYXlK2GhhnFOC5EzpZ4S9mF6igP6XgqI2QonCMo0aGfWkoMk2R+ACIAek3A6VWMLy4QSWtag8Rc5NzsgqYi4WEoXbFJEoxDHR5ghcAOSE7H+R6gCd0CJnMgm7glgf60x8uXbTxypQxxGJQjmJQhyTbI4eFwA5E2W6Tep/9Rrc9e1/vfr1fNW7dnZFH6vBelJBrbIuDstezOv3vy25nrsvEoUfP/uf1+veZ+wfO8Jmy5yNZYrNseMCoCCoxEIntEQm/E8KYMe/XGywmiDLU17gkJDrLJ1ao3JSFWoX9GfSn8394EWUKNS2/0WJAinqR32sy3H7WKNStc0RuAAoEMpQqWQWBjCH37W9rEXZ/vGH9q5anjJh5AUShfKpyuYIXACUgOx/2awK0a++YOY8MiQK5VOFzdHjAqBEKEMVvxzQtNpIoeDgU/fTC5P7MpTtC8e570d9LJ/z9e/vz79kBiN7MXKsh3Cm39nWZ5T34DgLZm0QHi7T5thxAVABNigUKOoLs5H6woLpQSuOjfJRikzTpUgUWtTHskUtvwybI3ABUBGmykepMk2MRl5MZ5NpMhUkCuVTpM1RKgSgYkySj4rLNNVtLpapUkaqTBPrJQqbrYU56yc+F2Vz7LgAMIQqFQoU9QUa6b5uU3lqGEySMorLNMkDL+Lfbd3WnW0aedscgQsAwyhToUBRX7gry1OTMO0ZiUL55GVzBC4ADKRo+ShVpsnh7OWV7y7Y3McaFSQK5TOuzdHjAsBgipCPiss01a2PNSpFSxmpMk2UKHwORB9riHEjdWMcm2PHBYAF5KFQoKovkIr4JJSnhqEIKaO4TJNIFMJxI4/vz7XKlmkylVFsjsAFgCWMqlBwS30h4zTcSQaJQvkMY3MELgAsYxj5KFWmKRw3MoF9rFFAolA+WW2OHhcAlqKTj1Jkmqg8tYlMfzSGkTJSZZp640Ymt481KoNsjh0XAJajKhTE1RfynoY7yeikjBSZpk5V40bqRprNEbgAqAFx+ajwmHXB03AnGSQK5aPaHIELgBoRlVgu3an/3EUfqziQKJRP3OYIXAAAMCJIFMqHbI7ABUDN4A67ZP/+1x8ZADUFgQuAmuFyfhm4ziwDpYBEoXwQuAAAYAyQKJQPAhcAAACrQOACAABgFQhcAAAArAKBCwAAgFUgcAEAALAKBC4AAABWgcAFAADAKhC4AAAAWAUCFwAAAKtA4AIAAGAVCFwAAACsAoELAACAVSBwAQAAsAoELgAAAFaBwAUAAMAqELgAAABYBQIXAAAAq0DgAgAAYBUIXAAAAKwCgQsAAIBVTDFgPEen52uMOVuu4x48utfcYaAQDs/OZr/uzj4LePCD/Mxj3v7R6cV3V/7VTuvhnzsM5MrrD78tOdz5joHSCLzrWVrZNjPSjoscqXiZ228+tLcYKAx6qY9Pf38rgta++LIhHOo22b0XyECevPr1fHXm+pszsrH4clZ5vDbjzbzFes+Po7/+/S6tbZe7Yn2zRuxRQ6zx/cP3f2swkDvkU0TQOox/RsmZbWvbGeab6S/tcW+LM74U+7jDGN9ZWZw/YCAXKPMXTnRX/ONa2vc4zHn32f+8jl3AeKSsaSa+fids3GD9TpXomL7ej0/P3/o+33n68M47Zhi0tr/qzm5xHmwM+NaOLRUGk+0toUTBmZ7aVde5QscWX54pcMGRlkOsVEUvdTzrvxQL6oWwMpWwGspvO0AZa3g0DvSSB8HOkwd39uiLn3+52HBc9owpdnc4e/k5uNo00e6mOtK/nLaf+SxxR4tEoSB0iYLG5h+FT2mZ7FO0pUL6S9MWUgStNusPWuRIn7NwUfWgSC7KKW1s80eDMv+kUhUtrivfXRAv7obru8tBz+5xwjLWsXCwDGRCrmn1ZRa237madpsyaBFPHsztkd05p8ThC9xhq1jv2aC1TSVuEbTIrmrQokRh88ni/PLK4lyTB2yTxfwKC52qs398cnEIOw8HJQpJ61zwMfCDZY3N75q+tlN3XLTYRP057K3EPydHeu17YmfV7Lx53250PX/DZc4z5bd3nIA9fyxeega0aLbwtLg2k7I4srvv+tuO4/yoPOqgbJtOljWt+/1k98ALqD9wV3nUMcnupuwA3ginx72v9tPKU5QodGem9loLzcv+35e6vgnjKgym7bjS1jlTqglxdD7FxJLtrcAFR1oOWUtVOo7en68xz6GmakN5hPJhDI0D7Yg1vT6sw9HYveNwvvn4/vxLViFVO9JYyXs76TkShWLQJQpUqelOe9tqknD7Z9hh85vABUdaHmm1/qyLS0XTh9kTfZjnk2r3PNa0jtcnv22LbDTpNFal671KR6rrYzEkCoWgSxTCPta1t7nybfMjG4I0m5vS2w0DFxxpOYxbqtKBXW8/ea/pNHRlLRHUtj9NXT5vLSzk8mdlpQpHmnY6MwKJQkFoEoWRkgQVU23uUNOUwZEWSt6lKv2fpdnqX/utlW//NFTmZRtRckAnYPv+/qNmnlk5Om2LPy+0e0N51Cl7vZfpSMO17c7s0mGVpOdIFIpBkyhcip3X86Te4aiY6MspcPHY13CkOaLZwoeL6+n9O9usICatbFtmcqBDV9YSdl8uw+5lOFLN1Y0QJArFMCBROLiadjfzClgqOpuXXbKVgQuONGfKKlUNIm2rT9lpHeSjdHff8s48sxKetnW7a1WVWIp2pFKCjN1+lwkkCgWgSxQoSeAl7vhM8OXO69PzPTjS/NApMfCK6uB1LdtGDpTKgmrGX2jmmZVBZa2i1ntRjnRQHwuJQumJQqeq91dn8zJKtkNJPuVFHR2pZgvf8cU2+vuKTz4RUdlW1YYjSstO88DE5EDHq5PzVc8JA2xDedQpYr3n7UgzKOcgUSg3UagsSVCpypdXErgkdXCkJpaqBmFr2ZaSg8CboX/vNeVRx4aER2P3XCV28nKkWfpYSBTKTRR6x9FFkjDGwbki0Nm8CF9eaeCS2OpINVt48e/t7pi2uOJotvrG3ZS3MTlIowxViDwcqUZ9geggUfhCGYmCqUmCSlm+3IjARdjkSG0rVekwvWxL40a84HYmZ2rmmRWyO58Kdjm/XVoeVy5tHEc6QEUciUICBScKudyBKxONzS+FL9/Lw5cbE7gkJjtSzRaeRIc3bb6blrbVr+qmfJ2SAx26U3GjrvdRHOmgcSNIFNIpKlFI03K0BZ3Nx/XlxgUuiUmOtE6lqkFUXbYtWqbJVKLTtpSsNZRHQ9t9WEc6aNwIEgU9eScKeQhAmESqfNQYo7CMDVySqh1pkTJNplLVrpfGjSTV923PPLOiK2sNI5eW1ZGmqYxEIFHISI6JQql34MomT5sbH7iIKhzpKCr5dUNbXsnxpvwkJgc6xlXoHuRIRx03UjcMShRqnSTE0fnyYUq2VgQuSRmOdFJLVTqK2vWaItNkKrqyVuAI+9xLtk+aI81yvB2JQh+dohOFspV0TGFcm1sVuCRFOVJTZJpMJW2rH96U7356kdXuVWo42siwCt1JjrSIcSN1o8xEoWgtR1sY1ZdbGbgkeTlSlKqyM27ZFsnBaAyjih53pFlkmpAo9FNwooAkIYE0m6eVbK0OXMQ4jhSlqtEZVvV/Uo63F00WVXRypJyxF+L1/o6lyDQhUdBTQKJQuxPIeTOML7c+cEmGcaSTdLy9aAZt9b8W/4DkIH/0x7oduleYdFIQicKQ5JQoGKHlaAs6m8uSbW0Cl2SQI/0P7+sfUKrKH015heyJ5KAABqiiqyBRGINREgUkCeOh8+W1C1wSjSPtA4srPwbI6xDGazjayAC7I1HIiSESBeuVdEwhzea1DVzEgBfamHEjdSNlq0+l2lmb53+ZiuYKBxKFAtD5lUm5A1c2qs1dVmMeiRf2yf35NfHXXGDhlr4fz0k8GgzGxHXYD6xXHuzIz3zmP2diZ0tq+kenF/uH7//WYGBs6PTazPU37Shoqc5yacbzlxjIlU9fX166rvd/CY8uPeb+N/v0CX4ldz7RoZj/kl/VOnBJYo40TkM40X3hRNvHJ+erDIwNnagie/rcXxKZ/gLn/H/iz1cezh+sLM41RVb6jxlv5i1JPCGAjcaNrVmwR1/zINgU9v4p9i0dJAr5E08UeK+K8IWp/7jLA/4TrW3YPB+omhBKwXkz7eiAV4c+r3XgijtS0Zhu9T3kbEe86C/EPzW44xxioY0OXSs4Pv39Ld2FowMATxbnl3XlKbo35Prush/4zd5LLpqwIBMxW78VXzaoNHU17TaTFF2QKORHUqLg+W5L/T6yOa1t4VscrO3xkElCJFRAh4uWme/v0LNaBq4kRzrFpjrx7/EdPywjikXWjALYmlho7fDlFlGegYGQnY4/tHdFNnQWBP5P5CSzHnKRZVx6ycWu4Bk5BdKHZCARNfOkQ0ViV9ukJGBQPwWJwugMkyhI4mtb9GR+QFVnOChJIJvHkwTVt0yxGiGb1GJxrfHAz6Qr+Ki3M1g7en/+jo5eUnQXUX5NvNw4RKAhVAa4DrZF7+pFd9prthbmRmpGR/ZfCI++Tnu0831n8tTrKpC2DlhACdVIIs9yncv7jsLOW0kXxUGPflkyHlPRmetk/RmRzVu0trnn7Aqb/4C1nU4oCOHOhFq0ZPEvV5Ru+5ba7LjktlKUBZ1BGVESsqzCA7bZ+6TX/0JppR+ZDXWZv0rl16eL8xt5nKBSylrhzpdNOCmZ58I4VzfImdLPCPtfvUQBJXIFpURFicLyoPK3jsSSLao6N8SqCWfcCYPWO3btLuh8i/WBK29H+uTB3F5Uow77X+RE8XJHJZOTi0Mqv3Z58Jxe5CLuvkVlrSaVtcLy4QSWtcjWtOaoPEVlQco8R0nGdCBRuE0RiUKcvpLt9TdnKNky9urX81WyRZQkXMokYZD4sLWlwti28q5wpLnex4qVVbZ9z993mEP9r1Xxcu89utfcYRNErGSyJv4nyoJT60XfUZH2f/3+tyXXc/eFM/lx1EmpNqFKkZUh8kzOVKzzA7ojQ4nCJN6zI18isv0tUZ1aG1SiGhelZEunD7dE+XB50sqHN5qOQXhSkC7J7wwj9mxd4CrTkUaLbFlKj1BWIBba2qS83GFGeC3+3iyggwDLw9T38yDKdJtk/+iIcW37X5R5etfOrrB1g/VOULXKUnNBolBeoiCJbD4RaztO/LL8OEmCVaVCcqTRtrJBjjTLiao8iJVVaLc1S/0vKpvVtXwoSyacsR/pVKb4u1c62kUeMRaL/J/0kh//crHBaoK0tRc4pDQyS2tsmNOZeUJ/Ztjn9YMXdb+LlFaiKnud09oWZeCFqGR7VueSLf3dvtyB4+/I5qO2dqwIXKY40qhGTRdrX1ATsW79L3m8XfRWDul4e1F9rFGgDJUWeRjAHH7X9v5XzNZ9fSwTZmMhUSgXctzSt9SxtyvvwMkkwee8Na5vMTpwmehIY3c0mqx3i3utDndjZDbkB91/5n0QIE9uZLwsVoXoV18YL/MsCiQK5SPXNiXntLZtr+ood+BmoztwC3mcRzC2xxUej7wONnzeJWXrZhGN0nGI16h70vvh8fkth/PNxxYJ98rpzz73O6K+v1B2H2tUaFcgfjmgKQDREeODYaZeV8GNraM+lsg8100XeY7dcwzXuVjj39nWi5H34ERHZdaGaRC293bVO3DsRuw5P99i3I5L1bsrq481Kkr/yxr5qGFlmkzFBlWIIjPPsrBRPkqRacqlRFUmNspHxe/AyWpCEa0dY3Zc4fF2mpTLecPGgXfxY8WOEx6fXxMvd9+IbxMYRV3EdExVhUjMPMNJuGZVD4Yhvs4jZ2rcCduYL1li0VFrW0eNxNc2nwp2Ta3qyOPtIklYYr15ZJQMH7CCqDxw1cmR3pRVTtt7NI/KNPmovGSaTMUk+ai4TFPdhpUiUSgfU+WjFJmm0pKESgNXXR3pymJ46/tW/6uqi4YyG+oynwkH2qqLA01D6X+RKsR2WRfHlcyzQ5Nwn9T0zh8ShfJJ7O1WUNVR78A5nL38HIgkoaQeeSU9rqL07kzj5lhx1P8q+/h8WTJNplKmfJQi03RX9rEm4aJ6lfJRikyTLFHVfp1XKR8VvwMn1nqo5fj4/lyrzB75FL1sZWVJRco0mUqUlar9r0Llo6qQaTKVolUhqs48TaJM+ShFpsnqPtaolC0fpco0kZZjVa0dKhXCkZaAXGSvTs5feo6zW5R8VNUyTaZSxBHjuExTnctTw4BEoXyKlo+6JdN0kyRU19px6Ygo65282S6inFKVTJOp0C6TyirM5+u9T/KRjzJNpslU8lCFUNUXwsxzwsqwgyhCPsqEEpXJFCEfpco0ZR1eWjQuHGk1xO5ojCUfZbJMk6mMqgpxS30hwzTcSQeJQrnkJR+lyjRVpeWYxs3hDDjS8onLR0Xzv4aSj7JFpslUhpGPUmWaTMk8bQCJQvmMKh+lXpaPZpI1TfPhfacK4UirIeZAb3a99HIfn5yvJn2/beoipqNThVDUFzqmZZ42gUShfG5KtgH/SVeyjU0hbhc1vDRPEo/Dw5FWg3SgPGCb9LUqH1UXmSZTUeWjEjLPBVQPxgeJQvno5KNUmSZ2LXy44VeUtBeQ5WW3n0Vd2nHZs8iRHsgTK7bLNJnKkwdze2/et1/G5aOEE30nsqC7dZFpMhXliPFZkdNwJx1VPkqs8Y6UaaryqHVdSZSPYk5HXpYvc3jpuGS6gEyOVPa/WK982KZsVGwrz6iPZWIN1HZujU/h/BLl1/KIXvJLd+o/d1E9KI7YOl8OL24bXqKqA2Tzx/fmWlSyjfUOraomZFbOgCOtBrI73X0TWdH/woGCuoJEoXyiihqzsbUztOQTHCmYFLjDLtm///VHBgAwCqMnIANQJa6oKgSuM8tAKSBRAFlB4AIAGAESBZAVBC4AAABWgcAFAADAKhC4AAAAWAUCFwAAAKtA4AIAAGAVCFwAAACsAoELAACAVSBwAQAAsAoELgAAAFaBwAUAAMAqELgAAABYBQIXAAAAq0DgAgAAYBUIXAAAAKwCgQsAAIBVIHABAACwCgQuAAAAVoHABQAAwCoQuAAAAFgFAhcAAACrQOACheG6zh/kP3vM2zr+5WKDgUJ4/eG3JcdxvmOgNALverbvg3//648MlMJEBC56qbnH9+OfkSM9Oj1fYyB3Ds/OZo8/tHc5Z6uxjxvcZbtHpxdt2D0/jv7697vHp7+/dbn7VnzZiD1qvPnQ3mKgEMinCC9y2PfhtHcm1vf+4fu/NRjInb+ctp8xz9ulf6514CIHSguJXmrO+JLyuMGYs08vPRZafpCznLn+ps15kLa7apDd8YKPh0wOyFkmrO2QgAfbSBTyRZMoSNZmvJm3SBryg5IEWsc+C/bEl+Eut5aBi15q6UDFl2u676WXXiy0NhzpeMjFRc6SRYuLEPZ9xzl/kfBb6AVvH59c7MLuw0GZZ1pyQPYWv3RiHzWiROEMdh4dXaKQZHMkDePzRqzXlCShU7vARQ5UvNRnqgOV0CIL/GDZcdhL5VGYKaEPMxyaxXXJg2DzyeL88pP782s+5y3W/3KHcIdtkN3xgg8mKfOM8ZHWNdl7ZXGuyQO2yfrtfRcJ2mhoEoWbNe767nJCgtYIqzonF4eweXbkxiMQ61VJEi6FX9+h9V2bwJVhC9+RL/bTh3fePb4312I+X2dKpoQ+TDZkBpqwuKhEtXM17TafPLizJz/7/v78S1pwCTYnGtGuoE3/HRnoQ5McEKHzFLZdoHUtP3zyYG4vxZmilJURXaKgrvFHD5sdStCEzZuqzUVytoqkIRsySYg2HjcEjD8nez+9fyf83PrAlaHWL1/sZvzFJlYezh/Q57QI6ftijxrow6STloHSbvbK7y2u1kLzMun3ks1THCrRQIP7C5rMM0S+zPEEIU7cmYovP8YeoZSlQZcoDFrj0uYpCdoaqgvJUJJANleTBFkhe7o4vxG3t9WBS1frJwa92BJahOLlXkjJTtGHiYgy0LOEDPRmN9sSL+6gnxN3qAklWyK0+yTvCtIyTyLsqVy7C+rLnAbZm3ZkSRUGlLK+MCBRGGqNy6Q4oWTbkNWF45PzVTbhhEmCWH8JB+g61F6QFTL191kZuAbU+od+sQklO+30/bwJ78MoGWi8lJe6m80C2TylZBsyibuCtMwz4sZ5rnzb/Djkj1YrDDeglKVNFMZa45qSbYM7zuGk2jyWJJzR+os9uozKsAvUXkj7/VYFrgG1fmKsF5uIstNmWnY6SX2YvsWl9rEy7mazoCnZEo1JOBWnyTyJm5d5FOepElUYmmn9LyQKPfJa45qSLXFTXaD3jU0AtL5SDtAdiDLsgq7VILEicA2q9bOcX2yCnCn9PDU7ZRPSh4kWV+Lx9mF3s1nRlGyJWp6K02SekgPZlM7T3je9GOYusAksZekShaLWuKZkG1YXyJnXOWmQSQKtLxbbeMg+lrDNepYyLGF84NLV+iMKebEJ+nkDstPa9WGUxZXYxxp1N5sFXck2ojan4jSZZ//LnPO6jrOy2PyYVmGoYylrQKJQyhpPK9myWNJQN5unCEGIdc3X0/pYOowNXANq/aW92IR0pvTnsYRMqQ59GMpA0xZX3rvZLGhKtoTVp+LSMs+Izqgv8zjI054JzrQ2pSxNolDJGtckxY06VBc0QhDS3s2VxfkDNgIOG4HXJ79t06/yTH2ekAPl7sxuStmE6IgXe2fUv3AeHL0XztJzKONvKI86V/7VcuvhnzssR4q0Ny2ur7uzz4LeyUzVMdFudrPoxCALZAPXcRN3WQ5nLz8HV5t52/349Pyt7/OdvJwZ2Vq8xKS1tpbwmF7m592Zqb2q7f3mfbvhu/624zg/Ko86Rb57edtbQomCx72tlDaDEWv86LQt+uYBaR821Gdi3W8/utfcYQUggiMXCeJIcUAH2VwkwbcSM9pwXPte5pJgGsbsuDLU+m+yoiqDFnGTnYrmrfLIqkzp1a/nq0kZaJm72axoslPjT8UNkiCjwJu1KV0GssKQoHbSsKmUpdMqNW2Na0q2VlV1NEIQH4e5TjAIIwKXrtZPmPZiE/RyU/NWdzrL1D6MLFV5gaNmeJ0qylRZ0RwokBh3Kk4nQSad5+P7c608Xua80aidGJ2gDUgUOiavcU3JtmHy6VqNEESissu4VBq4BtT6jX+xCc1NeeP6MHJx6fpYVe9ms6DLTpkhp+IGSJDdaNyZ6DxVNGonlCicmZSgaRIFa9Z4mBSnVxiMO12bJgSR55UZlUoC14BxI4RVLzYx6KZ81eoEaeNGTNzNZkVTsiUqORU3SIIsScfRBjRqJ7MmJGi6RMHWNa4p2RKVi4KnCUEUeWVGUmrgyjJuxNYXW5J2U76qPoxu3Ijpu9ksDCjZEl9OxRVs90HjRgbpONqARu2kUcV8u0HjRuqwxnUl2ypEwXXjRsq4TkC4ZTnSLONG6vBiE31K0b1ZPXFK6cNkGTdiy242CwPETXsXPAuyu0bDkejk2ZQ2BeUuUkd+XuZ8uyzjRuq0xjUl20YZouAaJZ3SrxPQjqtQRzrMuJE6vdhE6EzF30snH5V3H0anMmL7bjYLmpIt0chTtkuj4UiMpXFnC1EvJnV8ShGlLF2iUPc1PkCgujBRcEUI4sbm8XEjZW44ZKmwkbcjzTJuRA4Fq/OLTejGp+TZh0lTGanTbjYrGnFTYizZLp2GI1FkU9pEdONT8ixl6RKFSVvjOoHqPEXBhx03UhYUuHJ3pFnHjRRxodZkBo1PGbUPo1EZqe1uNgsDSrbE0LJdaZknUUZT2mQGjU8pKFGY6DWeVrJlsc0I+Qc2JKOOGykLN09HmmXcSJVR2gR0WnzD9mHiGWjaiOu672azoCnZhmQ5FVfkuJG6odHiG7qUpUkUsMZjaEq2DfIPWZOGcceNlMWN1AfJvARekNSH6qgyL6oEUSjT5H21n1ISDH+GeLHXscBuo5OPYtd+a+XbP31U7a2TaaLdbHfam5iS4ChE8lHPWEJyJfh45V+1SD6KJIg4Y8IRON8xw2WaTGUY+ai45JNOpglrXE/ky0lc4FYfl+SjPk1dPm8tLIS2i0s+kZKOFzgkSdaI/56epJq7adKO1lE/GMaRdmf+tafRuSPwYmfg8Kw9O3XV3UjR4jug/xN2/AcFrt6uIFxct8pUvACdt7qicaiSA2Fn8eLztEMcxug42oBGi68TOCKpvXfn3aBEAWt8OLS+PEoaKHAJ+y8nJQkm2ztRXDGLI2W9aN5gyQEr/D7RLN2ZxLrzqOicKWU9zHFmU2r82M2OiKbSkAic53honOmBJlHAGh8DjUB1hyWvezoRu2Py4SKtKnCGrPQWeLHH59WJ2LI7t7fsCtjN5ojGoUpodtCmDZJYpkN+pet219LU/mNgjedEVl9OfSwb7J1Jzj6rI8WLnS+67BS72fxJqzTY8jLbxgBnijVeAGkl27zGjZRFJsknjeSI5OM4Q8FAMu6U91+sV4rtxD6mU2tLM56/xEDOXDLPnfqD+qnH3P9mnz7NMpAzn+iwwH8lPMAaL4ir6cuO47jqqcCObdcJhtIqjDlSlbsz18FZlWrcdeLmWgH3l6561xX+Rz7zmf9cJBA7YrO8Vbex6lWiuXvY4QH/qXdNAfbOgwR1l078OdZ4McTXOO+/KG4dmQJX3JGKJmmr7yFnO9HdgUrUuOtE7F7WPjWj07Kg2D2Zf8i5X7D5aCh3DxnJNDHFkcY04hzT5n3ZhnIvK7z/xnxfve+FNZ4jSWvc890Wsxht4EpypFNsqhP/Ht/xv6gT9ALYl8vLIrNiYCBSHosu/QWB/1PWS5Xy0qEf+E041OFQRYgHadzFLo4vi57MD1XP+7IN5QI3y6rjiDU+OsOucZuYSvqQHOlX3dkt8Rdd44Gf6Vjko97OYO3o/fk7OlAQqkBcf7MmFtoOel/pUAbqXwfbojzyojvtNVsLc0MdAJB2l5cOhUPdkvftGLhF7PL2dtiSvmlKz3Wy/P7I3i06OMM9h3T4frjyr3bowjIDtwjFCdyZXc7ZKln7y+Xh7Osca3w4xl3jNnArcI3rSGmLL345+PmXiw3HZc8ivawt8XIv4+X+glQG6IqKPvd5a9zrA9HLvRCeRJz26OV+B4faj1zbAQuoEvBRVBE2R7W7XOd0RyYqZR3EFQkmHVXdhZync+1tPh1DEgtrfDB5rnGTuSkVyq28cKSr1McaV09QUedumDZuuipi4pX7XR48z1usUukNDCUgW1dSylS5zA7qK2Vdf3OGUlZPOig2e+8ybx1HrPHbFLnGTcQt0pEmqHNT/+tsEhda7CQVLa7/LVqsMnKoTXKoVY9Vrwpa25QsSRHiosaNxPtf0Um49iQmaNJ5eoFD94RmixbBxRovb42bxhQ5UrHARFlwar2oC5bRFn9ZXqiN1LjXVJHNuhK+UNfi780Cmhm0XFatWfYGXr//bcn1XBqr/uNn//N63UsrSWWqMi5XRvZu0jqPjs9PRClL9sR7x6xH62ONCtZ4uWvcFKbKdKTxvkBPndvZF7u9Hz4HV5t1XGiyjxXQq1yh1lr0506EQw0Vrq+dXWHzBusdt26VbXda54dn7ZekwhFVGPYe3WvusBoSVhGuKWAFs1XKvWGNT5bEnltFhI4PVKSZL3Xrf8nj7WL7fkjH26seuiaR95FEGP1nUWPVq6LsMtUgqHoh13kdS1nybpDsY5kwXJDAGp8MhlLOyJOEgYprdbinQRkoXbD0g+4/Taw1k93p4E34cjv8ru0ONZYk9NX4TZmuLdc53YOk/hf1k21O0JS7QbMmDReUYI3XnylWMfG+QE9Qtnd83uF887FBL8MgKBuiAy4+9zui1rxg+p2J2L270O7C5t/ZVlqRR3+rLlNlwfZSlno3iN2I4Jq7zrHG60tlOy4VZdy3NfJRWWWaTMVGaR1FwsaYMlUWbJSPiss0kfOk4+1izVhzEABrvH4YE7gk8oir6fJRo8o0mYoN0jo2lKmyYIt8lHo3SOy01m12nljj9cG4wEXIF1v86y0wOjXTk48y5nKnzEBFWdCp050J5T7Ss7A38Ne/32UVk6AmfiBr/DbPyCJ7P7431yIldFFh2DWlwhC720k9lbtS464OV1ewxutB5T0uHSuL4U37W/2vquSj8pZpMhWTpHXiEjZ1rfGbIh+l3g1yOHv5OXA366RxJ8Eatxsjd1wqN0dco/5X2cfni5ZpMpUqpXWUMtWl7WWqLFQpHxWXaRLOkzTulh/fn2vV/UIr1ridWBG4iPCI6+3+V6HyUWXLNJlKmdI6ioSNLFMtTMqEgbLlo9S7QaRxN4nOE2vcLowuFSYhj7i+Ojl/6Ym+QFHyUVXJNJlK0dI6k1SmykLR8lG3ZJqE8+zOTO2VIdNkKljj9mDNjkuFdj60xReN7fXeJ6F81NiXO2UGyhn7kY6323TstwwoEye7cz94kdc4+0ktU2WBSlmUjUelrFwqDPKSfBS0KDHDIYAYWOPmY23gksTuxYwlH2WqTJOp5CGtgzJVNvKSj1JlmuS4ETjPZLDGzcX6wEX0jU/50v/KfE/DdJkmUxlVWueWhE2NRooXyajyUerdoGhW00Rq3A0L1riZWNfj0hGTeHmXRT7KNpkmUxlGWkeVsKnbSPEyyCofpco0lTlupG5gjZtFLXZcKvKIKw/YJn2tykfZLtNkKjppHUXCpoMy1fjo5KNUmSZ27S6MO9UcYI2bQq12XCpPHsztvXnffum7/rbjOJSdromA9U5knnd54O9g214M1I8Rdj8gu4e9gdPfO8K5LolHl2GNH3bPDbkTEPZu8KlgN6wwMKcjnOcSm9BZTWWANV4ttQ5cROzF3g684C3j/PJqxm2iXFIscYcq7H6GMlWxRPZuUSmLe2z/5nj7IuxdFFjj1VHLUmEStMjEy/yCLhKjXFIe0ct96U795y7sXjyRfBTD8fbywBovn4kJXAAAAOoBAhcoHO6wS/bvf/2RAVBTsMbLBYELFI4r+oqB6xg1Tw2APMEaLxcELgAAAFaBwAUAAMAqELgAAABYBQIXAAAAq0DgAgAAYBUIXAAAAKwCgQsAAIBVIHABAACwCgQuAAAAVoHABQAAwCoQuAAAAFgFAhcAAACrQOACAABgFQhcAAAArAKBCwAAgFUgcAEAALAKBC4AAABWgcAFAADAKhC4AAAAWAUCFwAAAKtA4LIA13X+wAAAICcC73qWWczYgWuKez8cvv9bg4Hcef3ht6Xj09/fcs5W5Wce87aOf7nYYKAQyObil/hLPXt0er7GQCH85bT9jHnebvwzrPFi6a1x75BZzFCBi/7C3OP78c+4w1ZnvJn20enFPgJYPhyenc2SPV3uvuWMLymPG9xlu+J5Gw41P47++ve7lCSQzZkSuBhz9o9PLg6xvvODfAmtYZ8Fe6zf3gTWeAEoa7whP3eY02GWkSlwDXCkkjURwN5ioY0O2fnNh/bWzPU3bfHlWvyZsPs78Usn9lGDHCoShvEgmx9/aO+yae9MWduXLGZvJGj58EbYLsl5CjpOwDYZ1nju6NY4D4LNx4v/b5lZhjZwDelIiUa00NrHJ+erDGSGMlBh57OAB9usPwPtBH6w/GRxftn13eWA8efKb6WEQdj7Yhcv93BQmYrWNudBX1mKbHw17TbJ3pzzF8pvQ4I2AtKXBGKtqs5TrPmdlcW55uMHc3v0K78dwLDGR2TQGn/y4M4es5DUwDWGIyUa3HEOkSkNJm37zqJsiF7kpw/vvKMPHj1sdp4uzm8IuzdVhyp2BBtwqNlIK1NRMnYlbEs2bi00L8neT+7PryXYuyETNNh7MNJ5Rr7kBuk8n96/0/f5ExHAkpIGrPHsZF3jzFIc9QNypM701G5CSZAc6U5ShH7zvt3wXX/bcZwfk/4Q13G3P01dPm8tLFRqqNcnv23Tr+qLUgWUgX7Vnd1SMyGCXujutLc9aGEdvRcvsOdssf6AR3TYtd9a+fZPH5kBHJ+ev/V9viMDcFVQmYp7X+0nrG1KxtYH/ftp7H1w5V/ttB7+ucMMQDgsLhIeh1UMOU+Pe1uqvcl58ozrgXxL4AV0kOCu8ghrPIFx17gt3Czugh0p0RFLVpQE5g9YRZgSuCgDFZnQNlOa0vRCO9fe5sq3zaFexp9/udhwXPaMGepQq36paW1/3Z19pmb8rFemej7sekizt8PZ3ufg6nnV9q46cIXO053Zpb6g8qjjc775/f35l2xITE8a6rbGTScsFabVQcM+1rW7kHVbufJw/iClRk00ZHllUsuHmpNUN+XXYYMWkVZaYVFvgHoLbEIZtkyVBZSykon1sc6UoBX2sYS9F0YJWoT0LfRzlEdY4wWscdNxyJGyhFLTuNvKQeVDVkGmVNWOS7N9D7Oh7szUXl71Zm1ppaIdbxXZaB5lqiyYWMqqYsfVC9ZpOyJXvOfNDssJjW/pYI3nv8ZNhAIXj31dpiMN/zzR/9p7dK+5w0qg7MCl2b4TByIb2iyqQaoprXwUCUOrzIShzJe6iDJVFkwqZZUZuKp0nkenbeFTQt/SUB5hjdec+KnCA7mtzNOZ0sks8RItMJ+vs9vlw1ly6nU8nZW2facXmsqCwibrRZ7q0ZRW7tbxPlKRZaosTFopS3O3U6xpvk5l76Kd+Mpi8yPZPMG3YI3XHNcAR0o0QnWC09/f2r7QpExTUh+rrBc6DiUiScfnWXQfqQ4OlZKelKsbVKZayDsZ05Fm77okaJq7ndJ5Nssu1ZFvCa/mJCcNWOM1pJKTR1X1v4osFWq277mXX0clKtuq98WITpG9gaLKKKbX+KsqZRVVKiR7ix0WSb414p+Tva99bz3PPtaoVNX/mtQ1XhWV3vXQOFKCJGCe0216lhNFBK5YH4tOZPYdb3c4e/k5EH0sA17oOGn9mN6/79Vm3g4175eabC6yTxJmXVMeUZlqs8orF0mU3f/KO3Bp7nZ+FNWaTROd56uT81XPcWiNNOKfY43Xg0rHmkT9r2ZK/8t4oc207bssvz6+P9cyLWgRaaUV0/X4TCxTZcHWUtYgjTvqXZua8VOvJ8m3YI3XAyPmcWlebKJhmtCm7GPRvxdLkGkqu481CqF81ID+l0kJQ5oEWSRhY3yNX2Pvhon9r7po3EnfgjVeLyotFSYxqP81jjrBuKVCzfadmu87JvSxRiWttMKoZMv55uMxTiuNU0axsUyVhSJLWeOUCnV9rFFUXUyCfAufCnbj8+0isMYtw7jAJdE4UqIzSqN11MCl62OZ1JjOgyL6MaO81BoJslTNTBspwt6jBK5J0bgjsMbtx4hSYRJpNeqIhpSPiibWFkYWlfy6BC1iQGklvI9UdMm2rqMYkqi6lNV3Nyhh3AjdDapbxq9czenEHmGNW4KxgUuiebGJBl2ALKL/pRs3IucH1XULHx/n4Tisr3xCAbwohxppOZ4ljWIYRjPTNjT2bhQ53065JH9j77jGXZ17KlHPcTnpzh3WuNkYWypMQlOjDhk0PiVLqTAPlfy6Me74lEFllEkqU2Vh3FLWoFIh7gbdZlzNSazxcjF+xxWHMtPH9+ZaKeXDXqYkynqjZko6lXwqC05qNqQprTToqPSoO95JLFNloahSFjnP45OLwwSZJtK4a9lwGrYoNNJ0WOMGYlXgkmhebKIx7PiULONGsLjSSytsBD2+tDIVK0gz00byKmVB4y47eWpOYo0Xh1WlwiSGkY9SS4VljhupG8OMT4mXUVCmGo1hSlnxUuGrX89XvSDt2L15qi4mMYx8FNZ4uVgfuCRZxqd0g2749+3O/Gsv7Xg7K2B+UJ3JMj6FXmrOmNg1ON+x23fgOlVPxraJLP0vClyBEyzDeeZDFs1JrPFyqU3gkmhebMnH6Nmt+1h4oUeHdrMiOUgqoxyIZSZefK4mFNjVjkGavemAUsr8N9wNGhNd0oA1Xi61C1wSjSNVgWhlTmQo24agTJUPWe1tu6qLSZDNu253bZBvwRovltoGLmLAi41sqCDSSivY1RaDzt51UnUxiTTfgjVeDrUOXJKUF7uDunMxhCfYev1DSgga9BlpTD6+P7fJQGHESlkMd4PKIWbzWZRiy2MiAlfMkc4mPB5bYBP0kAKtIuvsUKY/HctIfeavf7/4pwMGCuXwrD2LCkL5wO7lUuvAFXektH13vVC+qQdnO+LzRmyrX8hQv0kgdq2gEc/0fz45P0DgAgDkjZUXkAcRKgT0dAb3yZHSBeIpNtWJf4/v+Df6cNEFzy+qBGdnswwMRA4apIutQeD/VGf9RgCAOdQqcI3iSKXAqZR6GVc2alKQqgA+9x2oWQMAyqQ2gWtcRyqlXnjAogMEw8lGTQpy+nOX+atiN9uCmjUAoGymmOVIeRXhSJnoY7XGLVU9eTC39+Z9+6U86krlQxHAJr7/Ffax3BlS5r/b5cEmtO0AAFVhbeAq0pE+6t17WRMBbNv3/H2HOdT/WhX9r71H95o7bIKITX9eE/970Z2eWscOCwBQJdaVCmNK1299FvxvkcrWYf9rcX456n/RheVtKh9OSv+L/p7R9OfGle8uQ80aAGACVu24woBx7WwFLHhHjrT1cK7DSoD6X+KXg0hG6hn1v45PLn74HFxt1rF8KMuvAY3OxEVWAIBhWBG4THGktOMQ5cMD6n+xXv9rtU79r9j057Ug8KECAAAwEqNLhfJ4u8vdQzrebsJAR3l8nu5/sd4Qy7VhhvqZCpVfw1OZQfefON4OADAZYwOX6Y40GvXdjPpfTB6fPz45X2UWcTP9mftLovy6gD4WAMB0jCsVSpkm4UhJ726hrD7WqCj9ry3uOIc2lA9vZJp4v0wTAACYjjGBy3ZHGu9/OU54fH5N7Bq3P01dPm8tLBizg5F9LDreztHHAgBYSOWlwjrp3d3IRzF3gRkoHwWZJgBAHah0x0WO1L8Otn3mv+hOe83Wwlwteisri82P4pfml1k9Yf9rS5QPl6soH+atLgIAAFVSSeCaFEdK/S9RPnwnR32XLR8FmSYAQB1xhSPdL0tINhw3cnJxSIcvhCN9bsLx9qKh8iH1v5TxKWd0apIVRJnqIgAAUDbU44IjLQHZ//I5b7EC5aMg0wQAqDsuHGm5UMBW73/RLnTcXa8cN8IZ+5FOZYo/Y73VEwsGAIBa4cKRVgP1v0T5cJnKh9xhq1H/a+iyrYnqIgAAUCQ3x+HhSMsnLh8V639llo+CTBMAYBLpu8cFR1oNN/e/MspHQaYJADDJJB6Hl4MUj96fv4vfQ3I433yccKjCNpkmU5HyUT//crHhuOyZKh8FmSYAABignEGOlPpfPGCb9HXkSG/Kh+HxdtHHoqBFjpTKguhjjc+TB3N7smzLerveNtm5DuoiAAAwLpkkn+BIy+fW+BTOL1F+BQCAIbQK4Uirgewe8OAF3X9DHwsAAEYQ2YUjBQAAUCVGT0AGAAAAVBC4AAAAWAUCFwAAAKtA4AIAAGAVCFwAAACsAoELAACAVSBwAQAAsAoELgAAAFaBwAUAAMAqELgAAABYBQIXAAAAq0DgAgAAYBUIXAAAAKwCgQsAAIBVIHABAACwCgQuAAAAVoHABQAAwCoQuAAAAFgFAhcAAACrQOACAABgFQhcAAAArAKBCwAAgFUgcIHCcF3nDwwAAHJmYgPXFPd+OHz/twYDuXN4djZ7/KG9yzlbZQAAkDMTEbjeiADFPb4f/4w7bHXGm2kfnV7sI4Dlx5sP7a2Z62/anAcb8c895m0dnZ6vMQAAGJNaBy7K/MmRBt7MGWd8KeXb1kQAewunOh6vP/y2JJKAdsCDbfHlbMK3NBhz9o9Pf3+LRAEAMA61DVwUiCjzVx2pCGDvxC8d5dsb5FTJ8R6fnKO8NQS0m6Vg5HL3LQvt2MelsPhzFrM3JRDY6QIAxqF2gYsyf3KkFIhYf+bfCfxg+cni/PLK4lyTB2yTJQQw7jiHcKqDkX0ssZttJ+1mKUG48t2FlcX5Ddd3l4NeAIsT7nSPf7nYYAAAMAS1CVzkSCngUOavONJLHgSbFKyePrzzTn745MHcHjlUzvmLhB9HTrVNZUb6uQz08ZfT9rOkPlbER5kgtB42O/TBI/Hr014Aayr2bnCX7dJOF6VaAEBWrA9cso9FjlR8uRZ/Rln+1bTbfPLgzl7S7yWH+uT+/FroUHslxD6ozCh+7hmcao+oj3Xms4DsqQZ0mSAsxBOEONLezOfrrH+324hKtdjpAgAGYnXgIkdKgSWxj3XtLlCW31poXg76OaFDFTuEBIdKNGT/a1KdqtLHuqs+H5QgqKw8nD9IKdeGO93jk4tdBDAAQBpWBq6jv/79bsqBgC99rG+bH9mQSIcqAuEOCw8W9NGYtEMFg05lRn2sZtYEQSWtXMsdtoGTngCANKwKXPJAAJv2VEd6ScFGZP2pZapheHr/zrZwqAua/tcZOXRWY9JOZUZ01D7WqMTLteLLeLLRkDtdSlQYAABEWBO4NAcCDqhMRcFmlKw/DcWhdpTHs+TQ63ioQHMqkwgTBPWgSx6Qvak/ltj/EokK+l8AAInxgUtebFUPBFCZirJ+4ezW8wxYKpFDber6X3W4VEt9rJRTmSGyj0UJAisQpVwb5+akJwMATDTGBi7NxdaOCFvrVKbKO+vXQQ6VSpEJDtXqS7XxPhZTTmUSMkEYtY81KlG5Vj0+z+q60wUAZMe4wBVzpO20PtbK4vwBqwBy3GkONcKqS7Wvfj1fTTqVGdHxOW+VnSDE0ZRrG5N+0hOAScaowCX7WJEjvcHh7CWpMOTdxxoV6VDJsbMk9Q3DL9XKPpYXOIcsQaZJJgjf359/yQxAU66duJOeAABDApd0pGl9rMf351rjnl4rAnLsg/pfJjlVeSozrY/F6KCLQQmCCpVrQ/mo5P7XW/S/AJgMKg1cYR/r5OIwTaapyjLVMEiHqpOPqvpSbdq4EaLvoIuBCUKcUD4quVzbQP8LgMmgksDVd7HV6R82GJWpMqswmEK8H+M47FaJrapLtQPGjVxWcdAlDzTl2kZ40lMkRCgfAlBP3LIdaXSxNVGmKVRhMLRMlRVyqI/vzbUGyUdRQGEFMmjciEwQqjrokhdp5VoMCgWgvrhlOVLlYmsj9ig3FQaTUO4jdZTHDQooRThVzanMEDluxPYEQUVTrsWgUABqhiwVFupI08aNFKXCYBJRP6aU8SlppzIjPtYxQYijKdc2MCgUgPqg9rhyc6RZxo0UrcJgCho9vpBxx6ekncqMGDhupG5oyrUYFApADXCTSll5ONK0PlYVKgymoNHjIxrDXqqN97F0Mk22HXTJC0259kuChgAGgHU49H9v3rcbvutvO47zY8L3dK78K1Fe+nNHfvD65Ldt+lXdMZGKtzM9tZvgRKmPtT4pGX9WyI6u46bdPToQdt8hu6v2pt3s193ZZ0HvaPutnTElCNe+Z/zR9jLRrPGOsNiO7YdUAJgknPgX9HIHXkBqCkljJLSO9Kvu7FbCHSHqYz3vzkztTeIOKwsDkoZLEdj2ukE3/O9E9u7tgp1dlhCwGBKEgWjWeIdd+62Vb/809Bw3AEC5OEkfHr0XztFzaCfQUB7dcqR0IED0VrbZbUdKKgw7yPqzcXTaFo40SJJgCiHZK+Y4symKF0gQhkSzxm8SNAYAMBJH91BXyiJHyp3wpe/LXKlMxX2+g6x/NDQONRHqY3WnvVodbS+TtDUuPtt+dK+5wwAAxuEM+oYBpaw4pMKwiV7B+JDNu253TdP/QoKQI9r+F8qHABjHwMAl0ZSyUKYqCHKo3A12FVksGjeyaYpye51IWuM+89e/X/zTAQMAGENmrULXYT+wXh+rozyanXKnOPv0aewLtKCf62n/rghatw7KeA6DrQtAs8YBAAYxMHBJkVaf+0skFcQ5/x/lWy7De1+Q1ckNeaHYDdgzJsqByuMGVCDyJcMaBwAYRGrgil1u3acj1qlSQVP/cZcHbLP3BabSjkNsXtZhEPg/kc1d5r2Lfw9JR0XyUVCBGJPMaxwAYBS3Apd0njRyhJxnFi3BJw/m9mJ6fJhKOwJSHssPuv/UqV1wxm/koyJ756p3OAmMssYBAObQF7ikSKsomTjDSgXF9fjoxBvrOdQzTKXVo5apsqq2S3tL+ahxZbomhXHWOADADKbo/8h5etzb6jKfcZ+3xsk+H/VKLcvyPlI0lXYNsjr9UJmKe1/ti11TYxy1C9LjE78c/PzLxYbjip5Yr1y7pcp0TTp5rnEAQLVM0aRYztndLg9yPWItHWp0wTN0qKKf8ONn//P6JDvUuM5gwP3nYoe1zHKAyrVv3rdfyvtIUbl24lUgwgTBndktYo0DAKrB9Vnwv6JkslDUCx3No1oIDxUwvjTJ/S9Zpupy/49FjHVBufYLsYGab4te4wCAcpkqYyZWVD5cEzuC7cALaJQ8OVTR2zmfiPJh2WWqSS/Xhn2+a/H3ZgFNexYl07kOAwDUhilWIpFDbX7R4+v1YxzONx/XMBuuukyVWK49ufjhc3C1WcfyoUwQAlJwhEo+ALUls3JGnigD/mp3H8m0MlVfudZhq3Ur1ybdf0PQAqC+VBK4JJFDvX0fyWKH+urX81U6ls6D4C6VqbIeby+aeP+L9SSN1uqgdpL1/hsAoD6UWipMQva/jk7beyRwGslHrdnW/7opUwWiUGVwmaou5VqyNyle+NzvXPveAvpYAEwOlQcuycpik0ZH3HKopt9Hik1/XhNlqh1bMn6l/7UVlWuNPz6f1/03AIC9VFoqTIIcKslHyf6Xyf2YOpSpUsu1hslHQaYJACAxLnARVM5KcKjG3EcaVabJVG7ko5i7wAyUj4JMEwAgjjGlwiRk/+vVyflLz3F2q76PVPcylWnlWsg0AQCSMHLHpUJHyak0FAnKskg+6m1Z5cPY8fYzkfX/T93LVFWXa8NxIycXh3T4osuD5zjeDgCIY0XgkkiHWqZ8VNEyTaZSRbkWMk0AgCxYFbiI+H0kx2Hk1Aq5jySnEIsy1aooC7aeLs5v2NzHGhVpb5/zFoumXVN/L29708+jvpr4+Q2T7r8BAMzD6B6Xjqj/1cr7PhLUxJOJ7PAybu885KMg0wQAGBbrdlwqUj6KB2yTvh5VPgplqmz0lWvHkI+CTBMAYFSsD1wSmkclHSobUj7KVJkmU+kbn/LF3pnLtZBpAgCMg7WlwiTi41N8z98fJB9li0yTqdzIdb0/f5elXAuZJgBAHtQqcEnUeVTqfSRbZZpMRcpH/fzLxYbjsmeqfBRkmgAAeVKbUmESyviUWSof0v0glKmKIalcSyczIdMEAMiTWu64VKhnJcqHB9wNdrnDqI+FMlVB3Jp2zfnl1YzbbC3MoWcIAMiFWu+44pBD9d3gOWdOp9VzrqBAyN5ip/uCTmjioAsAIE8mJnABAACoBwhcAAAArAKBCwAAgFUgcAEAALAKBC4AAABWgcAFAADAKhC4AAAAWAUCFwAAAKtA4AIAAGAVCFwAAACsAoELAACAVSBwAQAAsAoELgAAAFaBwAUAAMAqELgAAABYBQIXAAAAq0DgAgAAYBUIXAAAAKwCgQsAAIBVIHABAACwCgQuAAAAVoHABQAAwComKnDxwJl1guCfDAAAgLUMHbhc1/kDsxQvCGaZ6/wfA0CDzWscgEkgc+A6PDubPf7Q3uWcrfY96P773fHJ+SoDuUM251PsWfwzz/G+O3z/twYDuZO6xgEARpEpcL350N6auf6mzXmwkfC4wR3n8Oj0Yh8ONT9e/Xq+Kmx+ptqcM7404820Ye98SVvjju90GADAKLSB6/WH35aEg2wHPNgWX87Kz4XzfBcw/lz842Xs29fIoZIDoMyVgZEgmx+f/v7WC5xD8WVDfs4Z+6h8K9n77dHp+RoDI6Nb41e+23z68M47BgAwisTA9UZk8uQ8Xe6+ZTHnKegEfrD8ZHF++eni/Ibruwuc8xfx30sOgHYKcKjDIctUZHPaVcUeXfIg2HyyOLcg7N10HPYy9qwh9gT75HhRrh2OLGu89bDZYQAA43DiX5Dz/Ko7u5VQEiTnufPkwZ29pB/y5n27EXiB6gCIzpV/JRzAnzvMAI7e/32Ned53K4tz68wgaJca9Gzet1MVn+10Z6b2WgvN+M5W/D1EUuA5W+y2vQ+EvXdMsffrk9+26den9+9sM0MYdY0DAMzhZsf1l9P2s6QaP5UEr6bdpu6FfiQyUxEMmsznFBA6sUcN9GPSGVimEg5fDVrEysP5A7I3BTaGcm1mxlnjAABzcMh5inLJrvjnu/EH5Dyda29z5dvmx2F/KGXaruNuqZ+Lz7Yf3WvusIowZcdFZSrufbWvlAQJKlOtD9NXod2u7/rbjuP8qP4s8V9xZ2Vx/oBVhCk7riLWOACgOhyR8XPls6GdZxImOtSqA1eRZSoTy7VVB648EwQAgDnED2dcUulJlEwW8nihqXz45P78GjW6mVI+pAMF1BifpPJh0WUqlGu/QAlC2Df0Zs7Ugy55rnEAQDXIwHVAzjOtpzIO5CCSHOqk3EeK+lhnPgsoMPX1sdi1cKCL8xt52pz6X+SYo/5XHOp/nZFDZzWGTrNSgqD2DVmBaxwAUC4u7YiodFb0y0wO1fXd5ej+V5zwPtLxLxcbrEYox63jvZWb49ZF9VbovyU5aDo+r1xXmCWHTgdC6nZdQd5/o908U+8clrTGAQDl4LAKqKr/VUaPi8pUX3dnnyUcb6cy1fOk4+1F8/r9b0uu55JDb8Q/d5jz7rP/eb2o/lcZPS5KEERJkHaRa8qjTtWHUwAAxTDFKuBR72Ln2tH783fKfaRGdKH2O5PuI2Ul3MVcO7sBC9Sj6FSm2mwtzFWS8Uf9nKZ6/ytWrjXq/lcWTEwQAADlUOlYE3kfiQdsk/UfKAjvIx2fXOza0P+ypUxVl3Kt1HFU+1gOZy+vfNE3RB8LgFpjxDyuJw/m9sihqvJR3GEbJuvxUZmKDpckyDR1xL/9eiiNZdjpNdrtRnJdav+rwV22a3L/K13HsZcgPL4/14JMEwD1p5Iel46w/+X5+6L/sqQ86gROsP703uiBIK8eV53KVEXKR+XV44JMEwAgjnETkMP7X2KnknQfiXY2VR+fTytTRTJN1pWpTC/Xpo0bie5jQaYJgAnEuMAlMU2Pb1CZynY1cdPKtaPqOAIA6o+xgUsS3UeqbHzK4HEj5vWxRkWqnYT9L7og/YWGHJ9CAYUVCMaNAAAGYXzgIuIOlSXIR5FDLaKcNallqirKtTGZpnaSTBPtviHTBAAgrAhckrL0+FCm6lFWuVbqOEb2vkHqOJo0zwsAUD1WBS5JUXp8KFMlU1S5VvYNk3Qcyd556zgCAOqBccfhh2UY+ai04/Cx4+3bys8Ij7cj4//CMONT0o7DY9wIAGAcrNxxxRl3fArKVMMxTrkW40YAAHlg/Y5LRXehVvxtO6IO1aAdF5WpPO5tqVk/lam4z3fgQAdzeNaenbrqbiRMu74Un+11g264vij498qJDk0hvq3j6Ls7OCkIAMhK7QIXQeWsrudvuMx5pj4jRXTG+SV32KryqONzvvn9/fmXDAyFplwb6gcyx5lFggAAyItaBi6JzqHGgJp4Trw6OV/1nHBX1dB8m7Ax38S4EQDAqNQ6cEn0enwoU+VNir2RIAAAcmEiApfk518uNhyXPRNlqg7KVMUS3+1SWfDa99aRIAAAwAjQgQIGSgP2BgAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAABTJ/weSXbYA2/64TwAAAABJRU5ErkJggg==\"","export default \"data:image/png;base64,iVBORw0KGgoAAAANSUhEUgAAAisAAAIMCAYAAAA0B+ymAAAACXBIWXMAAAsTAAALEwEAmpwYAAAAAXNSR0IArs4c6QAAAARnQU1BAACxjwv8YQUAAFxoSURBVHgB7d3dctRWuvj/Jck42fsg47mC3S6bqZqjHz4IL5WDwGEwTPAVxL4C8BXYvgKbK7C5AjMQzJzBHOwimFSZOZqqwaR7rmB7/jVVA7Yl/dfT3TJqWVKru/WypP5+qmaI3UDCk5W1Hq1n6VmWAgAAlXr55u8t357d9i3VOnVPV1Zu/bGjcMFSAACgEvtHR3Nfn8899Hzvkf5yLvTRnk5atkhaekhWAACowLNfjx84nrWt/7KV8FM6tmXv/fDt/JaaciQrAACU6Pm7D7cd39nwlX87/H399Wv9f/+0LOunyC/p6E+3lq8v7qkpRbICAEAJpOTz1fncht8r+YSd+J63de/m1R354tlbveNiXd5xsXz19LN3uj6NpSGSFQAACvbyXXsj5lyK0t/bOp+d2VlZmj+J/poXb45XlWNtqMtloqk7z0KyAgBAQaTkY/v2rookHFLyOXOdtZVb8520X//yTbvl2u7mtJeGSFYAAMhZ91Vk56vd6LkUreO53tr9W1dfqxFI0uLPeNu+rx5Efz/L99fv3lh8qhqMZAUAgJxkPZcyrmktDZGsAACQg78cth+6yttU0XMpyn98fsXZjDuXMq7nbz9s2pb9MPr30t/b/DRz8nhlaSm3v5cJSFYAAJhA/1yKvL1zLfx9OZdinTnry9/Nv1cFmKbzLCQrAACMIe9zKeP/c7RbnuO9UpdLQx1dGrrThNIQyQoAACNIaZF/or/3OOlV5KI19TyLxJtkBQCAjF4c6oRAdRu2zUU+2ju9Yq9XkaRE9c+zbES/L+dZ6ta6P4g3yQoAAEOktcj3XX+rrJJPVnU/zxKNN8kKAAAJ5FyK58zKLsVq5KNOHRb9F4fta0p5++pyaei9Lg2tmFYaSoo3yQoAABGmnksZl+nnWYbFm2QFAICQZ78eP3C8pIsE7fVhLfJNJaWhc8d9ZCvrYeSjjuWpx3dvLkzUsG5cWeJNsgIAgKrfuZRxmXKeZZR4k6wAAKZa0S3yTVVVaWiceJOsAACm1st37Y2YcxJKf2+rbudSxvXzLx8fWbaS0lAr/H1dhtn57J0+zjNpGTfeJCsAgKnTb5G/qyILtJQgzlxnra7nUsZVdGlo0niTrAAApoYpLfJN1U1aHHfXUtbtyEcdz9Lx+Xa0+OQVb5IVAEDjhV6N3Yx81H019v6Nq5sKFyY9z5J3vElWAACN9pfD9kNXdRfNwXMSyn98fsXZnIZzKePqt+6X8ywDsZPW/Z9mTh6vLC1dil0R8SZZAQA00rS8ily0rOdZiow3yQoAoFE4l1IMSVo8x3ulLpeGOpayOkXGm2QFANAYCbci17JFvqlSzrMEco83yQoAoDF+fnu8FylX7J269ta0vYpctP2j9tzM6fkj27I3Ih8VEm9bAQDQTO/1/27POu5thZydKMee+V3MB4XEm2QFANBIrnIfK9ff0kWEjReHH3f33/y9pTAxedtn9uybdr9dfrjM0ykq3iQrAIDGWr61uLd8fWHe871/zjqzr6TdO0nLeORtH52EtF3lde/u8T1v3ff9P4d/TlHxJlkBADSeNCGzXfuO67nzsoj2DuIiC3m76uDwt1e2b3ffBJJ7fE6v2PNpFzzmHe8ZBQDAFPihd+hztf8K7r7eJdhQZ+7K8nd/eK9wyWAXWj90j89CJ8uvzzPeJCsAgKnSX0SXuq/gXnFkEX2dpYX8NOl2oT3zNj3lySvg7z3XWx+3X0oe8aYMBACYSpHzFW05X6GmnJxLkZJP+FyKjtFSHo3dJok3yQoAYKr1z1fMy/kKOUA6jedZ5FyKvMEj51KkE63c4zPsXMq4xok3ZSAAwNQLzlc8f/Phtu3Yu3p34afP7ue1ppeGQudS5DXkuS/nUoptojdqvNlZAQCgT8odUqrwXe9J7y2W5vZnefbr8YPZs2+Oegdo1YnnenfuXV+8U2a336zxJlkBACBCzlfIq7e6HPIvWUQPfvn4SDVEcC7F8ax9/eWcvIosCUOVFzwOizfJCgAAMaRUcf/64qPuImr51+p+nkVKPgfv2tvRcylyhkQZIC3enFkBACBFcL4iuG1YL6Lf1+1V5+BVZF953XMpvutvVbmTkiYu3uysAACQQR1b90da5J+4vr8i51JMTVTCwvEmWQEAYAR1aN0faZE/12+Rv/SnG4tPVc1IvCkDAQAwIlNb90db5Gt7OklZX1laOFE1RrICAMCYTGrdH26Rb/q5lFFRBgIAYEJVtu6PtMjXOyj+Wl3OpWRFsgIAQE7KbN0faZF/LTiXsnx9cU81DGUgAAByVHTr/miLfMtXTz979vrKrYWOaiiSFQAACtAvw8zLeZZ+K/mJz7NIi3znzNr2lNdq2rmUNJSBAAAoUB6t+6Mt8n3PW2/auZQ0JCsAABRs3Nb9l1rk986lzN+7eXVHTRHKQAAAlGSU1v3RFvlnrrPW5HMpaUhWAAAomZSG9A97z99+2Oy37t/7dP7piSQtUvLROym7rvJa+ue891xvfVrKPUkoAwEAUJFo6/5wi3w5l7J8fWFp2hMVwc4KAAAVirTuP/KU//j8irNZ9xb5eWJnBQAAA/STlhN75r+3V5bmSVRCSFYAAIDRSFYAADCEb6kT9Z9//15hAMkKAACGsH3/xLOtOYUBJCsAAMBoJCsAAMBoJCsAAMBoJCsAAMBoJCsAAMBoJCsAAMBoJCsAAMBoJCsAAMBoJCsAAMBoJCsAAMBoJCsAAMBoJCsAAMBoJCsAAMBoJCsAAMBoJCsAAMBoJCsAAMBoJCsAAMBoJCsAAMBoJCsAAMBoJCsAAMBoMwoAgJrbPzqa+/p87qHnez8G33OUs/vi8OP3p+7p1sqtP3YUaoudFQBArT379fjB7Nk3RzpR2dRfzkU+Xp11Zl+9fNfeUMiNJIcSU8uyfgx9u6WTw939N39vqZyRrAAAaun5uw+3Dw5/e+V41r7+spXyU1uSyOiFtP3i8HhVYSJVJIckKwCAWpGn+oN37W3bt1/5yr8d+ujE97x15fpr+q87Mb+0pZS1e/D2434RT/9Nl5IcnqjBeOeeHJKsAABqQ57Y9VN92/e9R+Hv68Vx6/SKPX/v5tWd5VuLe8vXF+Z9T62rmKTFt9QD/fTfLqpk0TQpyaHylP9Y4p4Q71ZeyaGlAAAwnDzV68VyV0XKPXrxfH3mOmsrt+Y7cb/u5Zt2y7XdTcuyfkr4rfWv87eWry/uKQMcHB6/cl1/6/6tq6+VASQ59HqJ4UC5JynuQ+K9N+5hZ5IVAICxXuonct/5ajf6RK91PNdby7qoyyLqOZ6UL64l/JSO5fvrd28sPlUVMiVZSUoOVca4p8S7M05ySLICADCOlB6+Op/biJZ7VO9cypaUe9QYXrw5XlWOJYc/Wwk/Za/KV52rTlZSksMTvcPy+P6Nq5tqBCnxHik5JFkBABjlL4fth666/KaJnI84v+JsrizNn6gJPX/7YdO27MQ3VvRnm59mTh6vLC1N/PcaRVXJSkpymEvcU+KdKTkkWQEAGKFfethWkdKBnI+wzpz15e/m36scmXiepYpkJSk5lLj7Of6zpMV7WHJIsgIAqFRe51LG9eKwrZMjL61XS0c//d8pozRUZrKSlBxqHVeXaP5U0PmdlHh3kpJDkhUAQCVCLfKjb5t0z0ecz87s5FHyycqE8yxlJCvDzqWUFfe08yzR5JBkBQBQul6zMEue6qMdUPdOr9jrZSYpYVKqOLfPV4edZ/nh2/ktVYAik5WU5FDoRMzeSnoFvChD4n2RHJKsAABKI6UHx3c2ok/1eZ+PmFRV51mKSlaSkkNT4j7sPAvJCgCgcFJ68JxZeXpejXzUMakpW9Szt8cPHKu7yLcSfsp7/fS/kldpKO9kJSk5VN0W+f66aXFPijfJCgCgMKadSxlXWedZ8kpWUpLDWsQ9Gm+SFQBAIeR2XseLeUr21dPPnr1e9vmISWUpDVmeenz35sJYDevEpMlK2rmUYVcTmCYcb5IVAECu6nIuZVyyiPoz3rbvqwcJP6UzbmlrkmQlKTnU3nuut17XuEu8SVYAALkoqkW+qYooDY2TrKSdS2lK3G0FAMCE5Hbe2bNv2tFERZcjtk6v2PNNS1TE8q3FveXrC/PyZ1Td3ZRLVmed2fbB24/b+2/+3lI5k+Tw4F172/btV9FERVrkNynu7KwAAMaWdDtv3c5HTCqvV52z7qxIcph0LqWIqwmqRrICABhZ1S3yTSVJi+d0W8lfS/gpHc/S8fk2Pj7DkpWk5FA1PO4zCgCAjEJvm2zKc3xI95XY+zeubqop9kNvJ2kp5TxLS8o2Lw4/jnSe5SI59FNa5F9fMP4V8HGxswIAyCTpdl45H3F+xdmsQ7+Usj1/+2FzWOv+8G3D0Z2VweTwkkqvJigTB2wBAKmk9HBw+NsrnajIYc2LREXOR+jSw5371xcfkajEk50m27Xn9Y7Ik7jPJQmZPfvmqNcOf5Akh3JoOZqoBHFfvr6wNi1xZ2cFABCLcyn5enHYvqbTEznP0kr4KR29LOuyjv9nx7K+j4u7yVcTFIlkBQBwScLFd7VqkW+qDP1ZoqY+7iQrAIBLfn57vBd5DXfv1LW3puVV5KLJW0Pn9vlq2nkWUderCfLGmRUAwDDSs+P2rOPeVsiFvDXUfXPqzF5S3RuQBwXnUu7eWFghQSRZAQAM4Sr3sXL9Lf2cv/Hi8ONuEd1Yp5EcoFVXvFeqV2obSFgsZbVsx2opdJGsAACGCrWW/+esM/tKOqiStIxH3q7SSV+7/3aV8j1v3ff9P4d+SofkcBDJCgAgs/6ruHdcz52XpCXulVvEk7er5BVwaQqnv2yl3ZtEcjiIZAUAMBI5b3HvxuKqJC366f+h7BK8+N9/XFOIJY3dunf5OLNteR1ZzqOcuva8JH7D3u4hOewhWQEAjEWSFv30v9QtWVxx9ilZXBZp7PZeDs3eu754Z5RDsySHJCsAgAlFShZt2UVQUy7S9bd7LkUSu0ka6U1zckiyAgDIRdBaXkoW3af/KSxZyLkUSSLkXIqUfOTepKRzKeOaxuSQZAUAkJugZCHt+OVtFtldmIan/9C5lCP95erFuZQC702apuRwRgEAkLN+uWNeWsv3DoZ+1Iv36dbKrT92VMM8+/X4gXNmbXvKa6nevUkrZd2b9EPv7Mvq8zcfbtuOvauTw58+u5/XmhZndlYAAIWRkoUcDNXlkH9J0nLwy8dHqiGCcymOZ8nlhHPyKrKUZ6q44FH+nvL39l3vST85bNR5FpIVAEChuq3ldTmkm7RY/rW6lyyk5HPwrr0dPZfSbZ9fsaYmhyQrAIBSBOdZ6tydNXgV2fe9R8H9PUWeSxlHE5NDkhUAQKnq2J010iL/xPX9FemXUkXJJ6smJYckKwCAStShO2ukRf5cv0X+0p9uLD5VNdGE5JBkBQBQGVO7s0Zb5Otv7QXnUkwq+Yyizskhry4DACrXfwV3SV517ndnrexVZyk9uGfepqe8OTmX4usyisnlnlEErzq/fNNueY4ncd5QZ+7K8nd/eK8qJMnh1+dzD3vXEvjyLUkO11eWFrqJITsrAABjVNmdNdIiXy+S/prp51LGZVLr/vD9ScGhZf3PthbewSJZAQAYp8zurJEW+deC0sPy9cU91XB1SQ5JVgAARiq6dX+0Rb7lq6enrr1U53Mp4zI9OeTMCgDAaEW07g+3yG/auZRxFd26P3QuRRrVzUly+Nmz11duLXSG/Vp2VgAAtZBHd9Zoi3zf89abei5lXEW07pfkcPbsm6P+uZT3ci7l7o2FlZVegjQUyQoAoDbG7c56qUV+r/Qwf+/m1R2FWCYlh5SBAAC1E5Qsuq86O93urN8nlYaCV5H9/qvIZ66zlqX0gIs4P3r5pr3j2u6mJIdK+VvDDh9LcvjV+dxG/1oCJcnh+ezMTvAq8qhIVgAAtSVP//qHvedvP2z2u7PufTr/9ESSFnmq1zspu67yWvrnSOlhnXLPeKpODikDAQBqL9qdNdwFVUoP0lOERGVyaa37Iy3yO3IuRUo+Wc+lpCFZAQA0Qrh1f/eVWOU/5lxKMcpODklWAACN0i9ZnNgz/709bf1SylRmckiyAgAAxlZGckiyAgBoHN9SJ+o///69QiOQrAAAGsf2/RPPtuYUSlF0ckiyAgAAJlJ0ckiyAgAAjEayAgAAjEayAgAAjEayAgAAjEayAgAAjEayAgAAjEayAgAAjEayAgAAjEayAgAAjEayAgAAjEayAgAAjEayAgAAjEayAgAAjEayAgAAjEayAgAAjEayAgAAjEayAgAAjEayAgAAjEayAgAAjEayAgAAjDajAKAGXhweryplbdiWvffDt/NbCoXYPzqa+/p87qHnez8G33OUs/vi8OP3p+7p1sqtP3YUcvX83Yfblm99r5CInZUGkclcTyjtl+/aGwqFI97lkIn84PC3VzpR2dVftvQiuilx7yUvyNOzX48fzJ59cyQx1l/ORT5enXVmXzHe8/Pif/9xTca27dt6fKtW6KOWHuO7+2/+3lLoshRqTyZzx3c2fOXfDn27o5S/tXx9cU8hV8S7HPKErxfObf2Xq0k/x1LW68/u5zWe9ieTMKaV/vq1jnFLDS6komP6eD84PH7luv7W/VtXXyvDyNj+6nxuw/e9R0N+aqcuO4lFx5tkpcaYzMtFvMsRKkPIRB5+uj/RC+QTHWUpT7Qiv2yPEsXoUhbNE9/ztu7dvLojX/z8y8dHlq0eqkjcLV89/eydrpsYd1OTlb8cth+6KnbniuQwBWWgGpIJRrZi9cLZVoMLp0zmj1V3YPfIk5Leum2zpTg+4l0eecKPK0PIJH7q2kt6sn5ku/Ydrxf3sG6J4kAvqgqZBGM6mqjo2G+dXrHng0RF3Lu5sCNx931JFr/wLfWA8Z6NjG0pX+pEReIaTVQkOVy/d33xzvL1hXnfU+sqNK+obvJi7R68/bg/rXFmZ6VmZMDr+ma3dh/+vkzmZ66jn+jnOy/ftFvnjvvIVtbDyC/vWJ56fFdPPAqZEO9ySO3eujKzHS1DaO8911uPe1qTuLu2u2lZ1k+RjzqU5JJlGdNpv17i7jnevv7La5GPOibF3ZSdlZc6ufCdr3ZjxnaXJIfnszM7K0vzJ4O/LnF8C+N2EikDoYvJvFzEuxxZyxBpXrw5XlWOJYc+W5GPKA2FpCyaHT2m10ZdZFLi3rF8f/3ujcWnqkJVJyuhcuZm3Ockh6MhWTEck3m5iHd5kmr3UuI5v+JsRp80h0k5V7Hz2Tt9PK1xz2NMp3n+9sOmbdlxbwhVOt6rTFbSzqUoksOxkKwYjMm8XMS7HJOWIdKwuzUo7zGdJK1koROZzU8zJ49XlpZy+XtlVUWykvRWVR/J4QRIVgzEZF4u4l2OvMsQ6X+vlK3zM3dl+bs/vFcN1h/T8ubawJ+/+7bJmbO+/N18IX/+F4dt/ffrxr0V+ahT9ngvM1npjm17dlsOHMd9TnI4OZIVgzCZl4t4lyOldn+iv/f4/o2rm6og01aSK3NMp0krWei43ykj7mUkKymv2XeRHOaHZMUATOblIt7lKasMMUzS1rk8hTahdX9abxoZ03FvmxSt+5acfb5aVcmi6MUzuP5BXf5vWZAc5oxkpWJM5uUi3uVI64jqV3Tosakluf6iKSWf6JP93ukVe73sJCVqWMmiqPFe1OI57FwKySHJSqMwmZeLeJcjpXbfcX1//U8Vv7Eg+iW56F0sorSn0DyYOKbTPHt7/MCxuklVK/JRp4jxnvfimaGDNclhgckhyUrJmMzLRbzLYWIZYpi6luRkTHvOrPxzr0Y+6tQhyU2J+3sd95W84p7X4pnlXArJYfHJIclKSZjMy0W8y5NSu9f/3PbWJG9TFS1l69y4C+TqOKaTlNGdNY/FM+lNwb4OyeEXRSeHJCslYDIvF/EuR93KEGlML8k9+1U/JXuXn5J7Fwnq0oPBYzqNxN2f8bZ9//LO56RXVUyyeKZ0sBYkhzEKTg5PSFYKxGReLuJdjpTavVzsuF7ns01JW+dV3S7cpDGdJu1tlnHH+ziLZ0q33y6Sw2RFJYfB3UkkKwVgMi8X8S5Hk8oQw1Rdkiu6Rb6p+m/JSYLeinw0ctxHXTzTWuSTHA6Xd3IYbcpJspIjJvOu0s5XEO+uUuJdZJdfU1W1u/XyXXsj7jBn0u28TZNWshjlqoqsi2dSt98+ksOMckwOY3vUkKzkhMl8QKfoUgXxHtApKt7j3D7dNKlb5zleIDeNYzrNpLcND1s8U7r9dpEclp4cpiaGJCsTYjIvbzIXxLuceE9rGSJNUbtbprTIN1VaycKzdHy+jY9P0uKZ5VVkksMBnaKTwyxNOUlWxsRkflmRpQrifVlR8Taly6+pkrbOuxfInX96kjXuVV77UEej3jYct3imnUtRJIddZSaHo9ydRLIyBibzdHlN5gHinS6veFOGyG7Skhxjejyj3DYcXjyztMgnORxUcHI4cmJIsjICJvPs8jhfQbyzmyTelCHGN+pt2tPyKnLRstw2LIunr9QTvcx9rxJa5JMcpisgORz75QeSlQyYzMc36mTe+zXEe1yjxHua3qYq2rCS3Nf6LxjT+Ut/BdeS1gVxb/iQHI4op+RworuTSFZSMJnnJ8v5CuKdn2Hx/i/n6x8pQ+QvZetc4smYLsCQ24ajSA4nME5ymFdiSLKSgJpyMZImc2ly5lvqtiLeuUpZPAfwpJmfIa3NhfHXPtTRkLiTHOZkhOQw16acJCsR+0ftua/O/H1qysXJMJkT7xwNibcxt083TcLWuZTh5upwAV7dpLwxSHJYgLR5pYgeNbbCgK8/qblIoiKT+cq964t3WDjz8YOeNO7dWFzVw29JdbcPBxDvnA2Jt97VjX2NExOyLfWj6u0UdoLvucp9rHQSLhdtvjj8uLv/5u8thYnJTvjs2TftfqISXSBvzzrubYVcffr65MS2nf+L+ejEUfb/U58+5TqvkKxkwGRejNBkPoB4FyMh3i29cO7qhbN98Pb4gcLE5E0Iiafru7f1E/2S7/t/DX++fGtxb/n6wrx++vznrDP7Strrk7SM5yLWytuRr33PW9fx/nPop3RIDvMXTg793m7hFzP/dc33/D/L2M4z5iQr6foZOpN5nsKTued6K5GPW8Q7X6nx9tWWntyf6L9q+Za1z4Q+PnmL7eDwt1fyur0c4pTdwbTSg/T1sF37juu5872J/XhVIZNQrF/pL1tSdji9Ys/HNYckOcxPXHLouHZ0Du/GXMa2nlusvMY2yUq6k37AmcxzEDeZz6iZzsBPYvHMTZZ4u5bbLRHpcT7fj/uqnlza3Qn96IgdrgwkTgfv2tueM3vkee6fZWHMWsIMSnQyz+gk/aEsBHKlhEIsiXX3okc9RqVcL2fb9O7VvCR+w85HkByOb5TkMBAe25Zl/TjpAyjJyhChgDOZj2mUyZzFc3LjLJ4X51pcf03J652+t6m3eY+Y0NMF2+F618oaNnmnkfjrf09L3ZLFFYckPUYQ6/71BHIX2J1hu1dRJIejmSQ5DEjM7367sCJjWz+Abo87tklWMmIyH8+4kznxHs+ki2ewZe57ar33nV5JjoVzkGyHy5PmuXIfSGnt/vXFR3m8+RApWXSTdDXlgliHSw+S2E1yAJ/kcLg8ksOw2HLcCA+gJCsjYjLPJq/JnHhnk/fiee/mwk64BCoLJxN6fzv87cd9Ka2d+97jot5a65cs5qVk0X36n8IkXWItY05KD/JULz2XJtm9ikNyeFkRyWHYQDluhAdQkpUxMZnHK2oyJ97xilw8B0qgevtX9UpyR9M4oYe2w2US/5teNJeK7k0TxF/OG8nbLLKATMN4D8X6SH+5elF6yGn3Kg7JYTnJYSBSjtvI8gBKsjIBJvMvypjMifcXZS6e3bjrJKhfkpNOoJvTNKHLn1OeAPWfu6UXzTuj1OvzIMlnd3fR9Z7k/TqoaZ79evygH+tNJWNtwtLDKEgOy0sOA/1y3LyU44aNbZKVHDCZlzuZE+9qFs/QlvmW6vZrsXZlV6epE3qwHe4r9ZMsYPrPXulN38HroPqJ918ysR/88vGRaogg1o5nScffORljo7xVlSeSw3KSwzAZ2/LA1S/HxT6AkqzkiMm83MmceFezePa3zKXZ2RPfUg+aVpIL3qbS2+H78jaVSd2UJVGXJ95u0mL51+qepIdiPVB6kDGmKkZyWC554ArmlrhyHMlKAZjMy0W8yxcuyaleO/nVJvSukCe67ttU3vm/iqrX5yH0tlxtu7MOdkH1X8tTfRmlh1GQHJbvUjmu/wBKslIQJvNyEe9qhGrOa73v1LP7cLRFftnnUsZVx+6skS6oJ3W4C4zksHwX5bh+636SlYIxmZeLeFcjUpKrTffhUVvkm6oO3VkjXVDn+l1Ql+p04zfJYfmCchzJSkmYzMtFvKsRvAJqevfhSVrkm8rU7qzRLqj6W3tB6aEOu1dxSA7LJWObZKVkTOblIt7lu9gyV/aSMrD7cF4t8k1lUnfWcBfUoPTQPRhe0yQljOSwXCQrFWAyLxfxrsby9fn3cSW5qhbOolrkm6rK7qyRLqg6xv5anUoPoyA5LAfJSoWYzMtFvKtx8QpovyRX9ttaZbXIN1WZ3VkjXVCvBaWH5euLe6rhSA6LRbJiACbzchHv8nVfAb1ckiu0+3AVLfJNVXR31mgXVMtXT+v0VlWeSA6LQbJiCCbzchHvagSLpryRoArsPlx1i3xTFdGdNdwFVS+Y3dt5795YWKnjW1V5ITnMH8mKYZjMy0W8qyFJWrQkl0f3YdNa5Jsqj+6s0S6ocjvvtJXYhiE5zA/JiqGYzMtFvKsRLJqTdh82uUW+qcbtznqpC2qv9NC4t6ryRHI4OZIVwzGZl4t4l2/gNu0vJbnMvSvq0iLfVKN0Z412Qe3ezkuJLROSw8mQrNQAk3m5iHc1Qotmpu7DdW2Rb6q07qyRLqidqm7nbQKSw/HMKNTGD72JYfXFm+PXyrE2+pP5huX763djDmrKBCNvnOjJvHPmOksrtxY6CpkR72rIoql/2PtZb5VbtnrY7z68d+qebq3c+mNH3oDwna92dSLZktIaO1b5ksXw5Zv2nmu7m92SxeFvHR3r2/qjk27pgeQ7F8E4f/72w2Y/Odz7dP7piYzxi7lEeS39c+Rcyvq0j3N2VmooeALyPbUuX0dbyTflvhNTEO9q3Lu5sBOU5FS/+7DEuUkt8k0V7s7afSW2fzsviUr+oq37wy3yJTmUhnOMc5KVWmMyLxfxLt+l27R9/4RFszz93cUTe+a/tymxFYfkcDiSlZpjMi8X8a6GxN3zvSfSn4ZFE01FcpiMZKUhmMzLRbwxLXxLnaj//Pv3CqgQyQoAIJGtdw8925pTKAXJYTySFQAADEFyGI9kBQAAGI1kBQAAGI1kBQAAGI1kBQAAGI1kBQAAGI1kBQAAGI1kBQAAGI1kBQAAGI1kBQAAGI1kBQAAGI1kBQAAGI1kBQAAGI1kBQAAGI1kBQAAGI1kBQAAGI1kBQAAGI1kBQAAGI1kBQAAGI1kBQAAGI1kBQAAGI1kBQAKZNvW74K/dpSzcfDLx0cKhXj+7sNty7K+VyiN55zNDXzjP//+vSoAyUqEO+M9UEADyUTuO/5u+HuyeL44PF5VyN3+0dHcwbv2tu+r8JzS8m21/eLwY5u45+fF//7j2sHhb69s336lv2yFPmq9fNfeUCiEzCl6Ftkf+OYV50iP7939N39vqRyRrPRJ0GWwW77aDn27VUTQ0cPiWQ5ZNGUcy0TuK/925OOWUtaujH3GeX5kgZw9+6bt+17SLkpL4s78MpkgIZQFMmZsd3m+t0lymK+U5DCwOuvMvsozUZz6ZGXIRC4k6G0mlfyweJZD4hwsmvrL1bSfK/8eGOeTkwRcFkZZIPWXF9vjOr6vfd9/EvNLuvPLwduP28R9NH85bD9MSggl3vqHTuhbrX5yeEScx5eWHMbFPM9EcWqTlZSJ/ESH/bEaDLroZopk5+NLWzx9pd4Pfs3iOQlZNHWcj6KLZkAmFs/17liWehr5qDvOOVcxmpd6jCY8aZ74nrd+7/rinXs3Fldd319Rl+cW5VvqEfNLNkFC6CpvR10e2+9lXEu8l68vzPueWleD8b7GvDKelOTwYozbrn0nJilvdR9A337cnyTmU5msJE3kMoGfuvbS8vXFRxJ0r5e0hLX62bl+EjrmbMsIUhbPTm9yWVjSMZ9n8ZxMhu3ZTjCZ37919fXdbxdWlOuvqcgTEecqsgmeND29AEafNPVY3zq9Ys/fu3l1J/jen24sPpVFNCbmohXML/LvUWFASkIougumju2SjOvgm/duLuwkLKC5lymaKi05jI7xH27NdyQpl7k8GnOdkD+YJFG01BSRCcC6MrMdU3qQbHw9PMgDL9+0W67tblqW9VPMb7l36p5urdz6Y0cZ4PnbD5vy4/0bVzeVIVJiLpPLVngiv/g1b/QC6VgyibQiH3X0kN/SyeSeMoBJ8ZZF86vzuY2UMxKJ8Q7In8e27Ifq8tOqEePctPEtT5p6At9UkXjJQ8+Z66yt6Ik77dcPmVuEEXE/ODx+5br+Vtz8WAYZ21+fzz3sP+hcIg+V51eczZWl+ZO030fi7TmeHAaNJoIdk+aVquMdkOTQd77ajTsekXWM5zmXT0WykjKRD53AAylBV3qC3/w0c/J4ZWnpRFWoLotn1smFxTObpEUzkDXeIm0BtXy189k7fVxV3E2Jtzxp6qd7OYh/adHTDz1roy4yEnN/xou+NXRB5pcfvp3fUhWpcvFMG9uyYFpnzvryd/PvR/k9k+ZyPb6f6vG9TnKYmhyONcZ/1jvjlq1kLm9Ffz/L99fv6h3HYb9H48tASXU2mcCjW7Rplm8t7iXUQLunzaXEwZZ5T1LMuwewzuyl+7rMlmXhlEVJbycuJWzhTv2hxCG1+5HjLcLbuCoyzqf9XEWkDBFOVIISxPw4C4zEPKEc1zWNb7MEb2cmjO2LUuaoiYoI5nIpYYS/P2mZogmCuTsmUZlojKeU41q+Ze1niXljd1b6Tz/yWmwr/P2s21dphmzfdvRT/50qsvOqnzyTYq7GzMbD+lu4cbXqTlVbuFXFO217tm/ieAdSt3HP3JXl7/4w8mIxrqriHXrSlOR7sGY/wq5VVik7iuK9nl9WypxfynzS745te3ZbEoeYj0/0v4PH57MzO3nFO2Uu71Q1r1SxsyJzt+M7G3FzSt5jPKUcl1qlaFyykjKR5zaBf/l7JQddVVCqMHDxzH1ymebFc1jtXhUQ797ftz03c3r+SE8kcYcRSxvnVYzv3m6GJSWfS+dSxilBZGXSeZYyFs+0hLBvT++Er+c5rsNeHLb1HN6dy1uRjzKXKfJiSnJY9Bgf9TxLY5KVlIm8O4EXOcGlBP1ET/A7ZdWbDVs8C5tcpnHxHHYuRRU8mYu0BbSMcxVlxjvlSTP3h540KTuK3X8WHfe9ouNe9OLZTwhjzwN2+9OUuMuQMpdPU3JY6hjv7yTGzeUDVYpGnFlJqrMF51KKntySaqDaXFPrzUkxD/p36HisFbVwyu/bP88yn3SepSmvJA6p3ZcS70BwnkX+firm3FYTxrk8aSY0LDzpv6a5VOb2vMQ87VXnOsc9GNvyuraKf7peC16xVyWRubzbtuLyXH4xr8hCr2pMxkpCG4lKxnjKXN4KnyGq9c5K0tNP2dl4WOrbFMp6/dn9vFZUdl7Gk2faE2dlZ0fefLhtO3bShFfYP1OR8R5Suxedql+3TNvGLeLcVpHxHvKkWfiuVVYpT6GFvc2S95O+xFovllJaW435uJBS5jiqOs9S1M5K2rkUZcgYTynH1bMMlDKRd1xdX/xTifXFJEO2bwvZUqxo8TRmcmnC4pmhdm9MvIWM83PHfWQr62HMx7mO86LG97Nfjx84XvdcSiv8/SofetKUfZ4lr8Vz2NjuJVt6wZzg5YciPHurx4d1eXyoguaVMpNDU8d43FxeqzJQ0K7dc2aPIovmxfaVCYmKGLJ9W5uurCkx704u0vFXFg8TFs6LLdyYzsN1eCUxZXu2y7R4Cxnn93sdn+fr1iU0KEPoRCX6JNepogSRVVCO09P3kop51VkZeDVI2vUPQSnz7o2FFdMSFZHSddjoeWXI3WAdk8d4XDmuNslKykS+Z9oEHpZSAzW+pXlSzE2eXOq4eA6p3Rs/mYuLBTRmQjftXEXQIj/tXIop3UzTLF+ff5+ldX+VV4MMuf7h4k4ZExfMqGAuT5hXjkyaV1KSw9qM8e5cHjrPYnwZyMRzKeMqunV/XtvkKbXNzB1/TVFk6/5J4z2kdi9qF+9AUsfKSc5V5DG+u7uEMWUIU0sQWQ0px4mx55dxyhLDrn+QBdOUUuY4UroOdyadVyYpA6Vcb1L7MW5sspIykcutyOt1ePJJklIDnaileZGLZ90nF5MWzwznUmofb5F3cj7J+E5rElm3h540w86zdJtunX96MkrcR108h7XIn7Qpp0kSW/dP8DJF3slhU8a4cWWglDpbsH01X+dERaTdvFpFS/O02mb/Jup5U8tsWSW1ey67xXZa7b77z9OQeIuBG1il9f+gUs5VpNzUW6sSRFYp5biu7tUgBcW9f/3D0bAW+U1JVESkbUUn+L7sbJQ1ryRdb6IaNsaNSlaSJvL+BG7suZRxpdRAW0G9WWKiCpSyeDZucqly8RxSuxeNnMxFN+76zxV3nqWocxWhg+Ht6JZ49Fr7Jkq7y0yF4i7jUk0o5c4kMdGdMnXRP1uRdJ6lkJcp0pLDJo5xI8pAKXW293oCX2/yIA8MuXk105b5KNvkKTEvvOOvKdLOs2RpsZ0l3sNq92qK4h0Y9zbtrOM7qQzRtBJEVpO+6pxUlhhWzizi3qQ6SLmGpZPlPMuwMlDa3WBNHuOV7qwEp/LVFecoeiq/n40vTUOiIobcvJpb98SUmJfW8dcUkS3c8ISa+SbQNCnbs13TFu/AsNu0u+N8jLindPtt7K5VFkN2FMXIXZ8jHawvJYWj3vbdJP22FUspO4ljzSsDbSTir4Fo9BivLFlJmsiDCbzJW7Rpkmqgoltv1iWbcUsVSTEPXo2d1skl78Wzvz3bHtYif1rjLcILqIob5yOU5MJliLhXkZtegsgqpRzXleUV8yHXP1wsmEVdflcnKdewdOeVg7cft7POKynJ4dSM8dLLQGmn8qdxizbNkO3bS90Tk7bJk2KuSr6wqg5SOg93olu40Xinbc8GvwfxjpflNu1ovNPKENNaghhFSjlOvNfzy4rML1KW8JXSibz1vTK8Rb6pRmndHy4DpbXIn7YxXlqykjKRM4EPkVIDFRf15hEWTyaXIUZZPM9n/71Tpxb5php2m7b8n47jP2V892/qldfsL5UgmvQqctGynGfRcdbzjp90ENeYe5PqIOXum45n6XXw26uvhyWH0zrGC09WUp5+mMBHlLKAnugJfufcO+/++xyyeErH3y12sIbLsniqXgLZUgn9UhTxHlnqZaC+eqosa46HnnwNucvsEpLCyaTM5XspyeFUj/FCk5WkU/ls0U4m7eZVTWrFLcUTZ24yPH1eQrwnl9Y8MYSHnhylLKKB2jflNEW367B9vpoylwcY46qgZEWeSL868/eb0CLfVCMsoEwuOcm6eBLvfKU9hbJrlb+kHcUmdFU20fBOz4xxUcjbQF9/UtFt2o7r+ytN6xZZpQw3rzam468p0joP970n3vmzZ5z/Ub2dwk7o27KDeHvWcW8r5OxEOfbM76LfdZT9/9SnTxO1TkCcT3INwv/EfMAYDynt1WXHUgzyAtiW+lFdnsjFiW1ZHZ6C8hdaPKOuzZ55R1XectskF6+A++7t096r5X8NPnOV+1gnjVt6c3ijrKsSpkFKb6CO7/l/7r1STrzzENNluRP+nDE+qIxkpb9YVn9deZOkTeSKmBciHHPP9VYGPvTVVr9PSy4N5aZZqG/KrhwoTGp0Fepj8U9ZRMdtJodLvYGUNOVUkcUzdD2IVfb9ZU0T6ZvS7U+jXDfaj4UxHlJKshK6M4GJfEIZJ3JinqO4mM+omU7457iW+6VLaC/uuXUdnhZBd2Xp0Ol57p+zNroK7mVxPXeeRXQ00Yseh90pE2rmd8eyrB95GBpNpKmeynpvEmO8pDLQQLtnJvKxjDqRE/PJjbN4Rm+9nbTr8LQInjT1rpU1Tgfr8CKqdxQf5nVJX1NFSxCj3vYduh5kSz8MbfMwlK6bFL79uB90WR6nU/u0j/FS2+0zkY9nkomcmI9n0sUzcuutCkpyTOiDgifNc+U+kNLapFcQhO5l2VJXHHYUY0RKEO8nuVMmtkzBw9CFgft8LPUgj3uTpnWMV3I3EBN5NnlO5MQ8m7wXz3s3F3bCJTnZ3WIBHXjS3D33vcd5vykYWURHuqSvqRJKELlcFjtQpuBhqOvZr8cPJBb9pPAk73uTpm2MV3rrMhN5vCIncmIer8iYx9x6KyW5o2lcQENPmrJo/k3vWi3JK+GqIP1FdF4W0WGX9DWVjG35b3ySEkQWkTLFxrQ+DAVJoeNZ0lZ/ruiLBqdljFearAgm8i/KmsiJ+RdlLp6RW29Pstxy2yTy5+w/abZO9YKW9XzEpILxLoejZRGVhWQaFtFwCUJ/uXpxLqXg2777ZQrpR7Q1Ta86B2fcoklh9GLZIkzDGK88WQkwkZc/kRPzahbPyNXxc1KSk12dpk7owZOmr9RPMpnqP3slt6vLk223FOp6T5q+iCaVIMqMu4xzSf77ZYpGPwzJny3oTyNJocS76KQwTpPHuDHJSoCJvPyJnJhXtHj2tm+lR84TOXzXtJJc6ElzX96mMqWDddAvRD/5/ksm9INfPj5SDVF2CWIYWayDcd7EMkXQnyZICk3p1N7EMW5cshJgIi8fMS9fuCSnek24VpvQRyF40nS9838VcT5iUhJ3efLtTuiWf63ui2iVJYgsLpUpav4wFOlPM9fvT1Po+atRNW2MG5usCCby8hHzaoTq/Gu979Sz+3C0s3JZpbVxhV7tr21b83CL/CpLEFlclClq2ro/pkX+nunjvClj3OhkJcBEXj5iXo1ISa423Yeztsg3VR3bmkda5BtTgsiijq37w/1pgqSwqhLyOOo+xmuRrASYyMtHzKsRvI5oevfhcVvkm6oObc3rUILIoi6t+6P9aZTy1+qSFMap6xivVbISYCIvHzEv38X2rbKXlIHdhyft8msqU9uax5YgrmRvkW8qU1v3R1rkXwvuTVq+vrinaq6OY7yWyYpgIi8fMa/G8vX593Eluaom9Ly7/JrKpLbmiSWIBsXdlNb90Rb5lq+e1qGEPI46jfHaJisBJvLyEfNqXLyO2C/Jlf22VtEt8k1VZVvzSAnipO4liCyqbN0f7k+jF8zuvUl3byys1KmEPI46jPHaJysBJvLyEfPydV9HvFySK7ThVtkt8k1VZlvzSIv8oASx1IQSRBZlt+6P9qeRe5OmJRkPM3mMNyZZEUzk5SPm1Qgmc3kDRBXYfbiqLr+mKrqtebRFfpNLEFkU3br/Un+a/rmUppSQx2HqGG9UshJgIi8fMa+GJGnRklweDbdM6fJrqiLamk9rCSKLIlr3R1vkd+9NmvL5JMy0Md7IZCXARF4+Yl6NUN+KiboPm9oi31R5tDWnBJFNXq37oy3yq7g3qU5MGeONTlYCTOTlI+blG7hN+0tJLnMfBdO7/Jpq3LbmlCDGM27r/mjvDlkw694XqCwmjPGpSFYEE3n5iHk1Qu21M3UfrluXX1ON0tY82iKfEsTosrbuj/buCO5NYj4ZXZVjfEZNmR96W32rL94cv1aOtdGfyDcs31+/G3NIUyZyedtET+SdM9dZWrm10FEYCTGvhuxu6R/2ftbbtpatHva7D++duqdbK7f+2JEnTd/5alcnki15SuUJMx9B3J+//bDZ7xey9+n80xOJ+cXYVl5L/xyp2a8T98lIvF++ab92bXez/zC0FbxRIgume+ZtesqbkwXTOnPW7383/15hIlWM8alLVgJM5OUj5tW4d3NhR0/mT2UytyxLdrdW9Xb4a/2Eec333C2eMIshT5E67nvBIqpj3tFj+7b+6KRbsyfuuQkeiHS8W/6Mt919GFJWRy+Yt5U0sJT+S8wnuStzjE9NGSiJTOTB2QrVbyMvdc2m3HViImJevku3afv+CVvhxQv3C+n2kqAEUaiB1v1fzkgsMZ8Up6wxPvXJimAiLx8xr4bEXU/gT6Q/DecjytN/8j+xZ/57m7gXr7+LqzgHVJ6ixzjJSggTefmIOQBgGJIVACiBb6kT9Z9//14BDVXkGCdZAYAS2LrU6dnWnAIaqsgxTrICAACMRrICAACMRrICAACMRrICAACMRrICAACMRrICAACMRrICAACMRrICAACMRrICAACMRrICAACMRrICAACMRrICAACMRrICAACMRrICAACMRrICAACMRrICAACMRrICAACMRrICAACMRrICAACMRrICAACMRrICoBZs2/qdAjCVSFYagom8WjO+8+P+m7+3FHL3/N2H2weHv73yffUg+J6jnI2DXz4+UiiExFz/MBf61tyLw+NVhUL85bD9UDnOdvh7jPFBZSQrrReHH3eZyIvxUsc1OpErYl4omch9x98Nf8+31INZZ7ZN3POzf3Q0J/G0ffuVr/zbkY9bvq229edtFtH8vPjff1yT+URiriLJilLW7sHbj/uM7/zIXCJj2FXejhqMt2CMhxSSrHz6Wp3oHzqhb60ykedLJvKX79obnjN7FDORC2KesyGLZ0Di/orJZXzB2J49+6atv1wNf6bj/loNzi0tWUQZ55ORmB+8a2+rK050PhmYy0nK8xE8ZPaTwlboo47lqXXFGL+kkGRlZWn+xHbtO77vP4l8xESeA4mfTOSe722qUDYeM5ELYj6hERdP0epPLu2Dt8cPFDKTJ00d56Po2NY6nuvduXd98Y7MLZ7yH0d+aTc510/+2yyio5EShIxt3/cGSg4S49Mr9jxzeX5CD5ntaFKox/zW8vWF+bs3F3bkR/9y0jLVY7ywMtAPt+Y7924sruqBPm9Z6mnooxYT+XiC2r3ETyVM5AmDvEXMxzPB4ilavmXt8xQ6XKT80Ap9dOJ73rqM6/u3rr6Wb8jccv/64iOZW6KLqH7yf8Qimk1SCUIS8FMdW4mxPHiG5/JIvFvBvEK8hwuSwv5cciFICu/fuDrw/Xs6aYlLFKd1jBd+ZkUG+t1vF1aU66+pyALKRJ5NSvnh0kQukga5IuaZ5bV49nWfiOSJSv5dKlxIKT9cTOL3bl7difu1wSIaN7dcLKL636PCgLQSRJCAr+jYRn9dhngzr8QIHjLjkkKJd5AUxv3acKKov3wf+qg1bWO8tLeBlm8t7skEL1tdqlcHDTCRJ0grP2SdyLsLaK9UEUbMExS0ePZ+vX6ikl0ankJ7ksoP3fF6Zi+lTeJhwdwSu6Oo/z2yiPZkKUGEH3qSpMSbUlxINyl8+3E/5iGz4/r+iiSFWeItZG7RMV+KTRSnZIyX/uqybHXpBXQp+gTKRD4oqfww6kTeXUD1fxRxCygxH1TC4ilawRPRtE7oKW9AfClnfjf/ftTfN2VH8SI5V1Nq1BJEFpQp4g28/GANvKXZTQp1vJf+dGPxqRpD5KE/rPFj3FIVevmm3fIcL7oVKTqn7qneivxjR5Xs+dsPm/LjOP/x5kG29KwrM9sxb5vIRL6WNRNPIn8+27IfqsuvyU1tzGXx1E8/cg6oFflo4pjLGHdtd9OyrJ8SfsqejvtWmXGvKt7ypOk7X+3GjG2ZxB+fz87sZEkGs/29unPLvv7L6BZ5Ry+nehdhcU+V7ODw+JXr+luT/jc8Chnbju9sRGMuCbif4z9LarzP3JXl7/4wcvI5KZ0Q+3phL3WN6yVoliQMrchH+r9zeyuuvDaulLml08QxXmlTuP7W1nzc1ta0vR6X9upgkI3nMQCSdrbUFMY8pXafW8xTas4BeSI6avITUUr5QewFT/Z5JSoiddu8t7N11ORxnmcJIotpL1NEXn5oBd8PzqXo2KzlmaiIi7KzspfUFIxxIzrYytaWLAwJW1uNnshFUvlBFTiRhxbQTuRjFs9yF08xJ9vzTXyrIqn8MDCJ5xjnqJRt82tNTM6LLEFkMW1lirSXH/QoX8s7KYyzfH3+fcJDf6PGuDHt9mXC6j/1R9+oaOxEnvbqYBkTecrOFotnQVImc9HqdgnVT2h1n1yS3oBQvS3qUibxsIS5RXT7hTRhEe33X4p7zV5KEEt5J+BpkuLdlHkl5eWHICmcL7sMI3NLt41CfKJY+zFe6ZmVNM/ffLhtO5fPEVjKev3Z/bxWVI2/jHp+Su2+U1Wtcf+oPTdzev7ItuxLA7oJMU+q3asKY17VeZYi490d2/bsduSpXuR+LmVcaWflihwLRdXzyzqXMq4Xh+1rOk2R8yytyEfv9fheKWpeKerMStIZN4n3mevkXu4ZR1XnWYoc48ZeZCh/2LinfvkPsq5bW8NeHZQt2ioWTZGys1XrmKfU7iuP+ZBynOg+EdXhMrOU8oOyfPW07Cf7NGln5ep0/40JJYgsmlKmSOm99D6tP00VgrlFziephoxx429dvtjaim+vXYuJXCSVH0ycyBMGuWDxLEDK4imMv8wsqfwQlNbu3lhYMWUSD0vaNjf9/hsTSxBZ1LVMkfbyQ79B5JIJSWEcOZ8U+9BfwzFufLIiUjqEGj+RD+teaOpEnjTIFYtnYVImc9EyrUto0hsQqj+Jm/Jkn6Y7tww5z2LSOE/rv2RSAp4kJd4tE8+zDLs3KalBpGmCuaXOY9zYMytpXrzRgXWS3mWfrMafVz0/rXavJ/KtugxyMeRshTExTzmX0rSYy+7Qzmfv9PE4cZ803vLUoyeTbRXpqiwk0TLhXMq4nr09fuBYlvzZWpGPOpbvr9+d4E2aSer5Kf2XpASxbnpSmCQp3rL7qcf3+iTzyiRnVtLOpVhnzvo4TQtNIXOLP+Nt+/6ltcnoMV7LZCXwsy5HWLaSBmet8Pernsi/Pp976PUy8YHGa3WfyFMGOYtnQVIWT9EZ57DcuPFOG9smHS7MQxEPRONM5BLzr87nNmLaGtQuAU9TRLzHSVbSXn7IoymnSeo2xmtRBkpiWrvntPJD9xZTw7doh0m5lLKSmKfdndSUmKeU40QraN0vT4KqQFlun25KoiKGbJv37tUquBzXlBJEFlWXKQbOuBXYlNMkkTYKndBHRo7xWu+shHW3zR1311LW7chHHc/SGfG32QbaOE+daa/FNi0bD+u37pcyRSvyUSkxL6pFvqnyetV5lHinbM12X0Wu6oqEMqVtm4+ys5X1qbM/tmU37Vr4+00oQWSRV5ki686KLJiuupSEdxfM8ytOrR92ssrrVecix3hjkpXApFtbo0zkKeWHqZrIJz3PwuI5mrRynNAJ5OanmZPHK0tLsZNslninbM1O1SQeljK3ZLr/ZthEPk0liCwmncuHJSum96epwqR3PBU5xmtdBooT2doKT6Zftrb0RKwmkFZ+mOQW0zoacvdNrjFPeH1wKmOeVI4Tk96mnXb7tJR8st4+3TQp2+YT3X8zjSWILIoqU5R9b1KdFHXHUx5jvHHJSiDpwr5JJ/K0VweneSJPu/uGxbMYKZO5aAXnWbJOLknXP6jQuZRpncTD+nNL6nmWrL9XpP/SYIv8K/U/c5WHpHh355URzrNUfW9SneR5x1NeY7xxZaA4ae219XbinfB2YtIWeUr5YSq3aIfpn2eJG9CZYz6N51LGNcp5lmi8U7ZmjWmRb6rUbfNIrT+8RU4JYjyjlCnCZaBnvx4/cLykV6Tt9SYdDs/bKOdZihzjU5GsBLLUQKMTedprVUzk6bKeZ2HxzE/KZC5OdAK5c+6dd/+7P5/9907Sq8iqd/ndFpN4Nilzy8X9NzKR+0rp3QHre3X5nFunqjuq6ijLXC7Jimd5d0gK85Hljqcix/hUJSsi5cK+gYlcFs6kU+KKiXwkKYOcxbMgKZN54H3/s0v9UpjEx5eyo7inp1v934EfTSJJwCeQFG85ZB692qSvUf1pqpCWKBY5xqcuWQmkPfXL1qCuabZUzGtVTOTjG7KAsngWIGXxjJLL79Z5sp9chpJcFyWIfGSNd90bRJpEYn5un68Om1vyHONTm6wEhnQIDTCR5yTrIFfEPDdDJnOe7AuStKNIAl6MtHg3qbuySZLmliLG+NQnK4GEp34m8oJ0e4XYXuzdScS8GAmTeYezEsXovnnSK2nKOG7J9+Rairs3FtYVChOayxUH8csRivlcUWW2xr66PKqg3bMa7M0yN2PP+OrTp4l6hOCysyvuNZ2oSJktmpCc2JbVIVHJn22pH9Xls0Ct4BXnA73LqDCxi1fAfff2aa99wl+Dz84t928KhZK5XF5DlldvSVTKEbzqXOQ1EOysRMgko748ecqCKZN7h6fPfASvs3nSyk1vE+p0+XaoJHSivjyFTnwDKHqCV8D11mxHYm479quLD321pb/fCm3jTnyL9rQKvcXWCj/R//z2eC+Ir6vctT9d/8OeAjASdlbSzPzXNd9T/S3b0RpsYVDQgVYvmvue5/45ocHYSaj5U8u3rP1xOyai36nz8LdXkqjI4ikxn1EznfDPcS33ogNxP+65dR2eFsHYlmZjMrZ5ogfyR7IyRORm55ZM5CygowmuJnC9838N2yYMt+9n8RzPOItnEPegA/GkXYenRdCdU5d8rKbdhAyYhGQlg4EFVPmvVW8BPRql5fA0itbuR2kdzuI5nkkXz6D2zI5iOhnbsmt1rtwHetdqZVqvfADKMqOQ2Q+9V9/uBCefZQHVE/kq51kGXdTu/cHa/Thk8dQ/7P38y8dHlq0e9hfPjWjL/mkXnAXSi6ecBVqZtAwhO4ov37SfBq8l9ncUp/48S3ds27Ny4/W1c99b5y4ZoBzsrIwhcsnTnCyg8pQ17U+f4YvC9JP9X/Os3VOOixe6QXZXL56P87xskB3FL0Jj+5WrvL9x6R1QLpKVCYRvdpa7J6Z5AQ3KD+e++/vgJk2VMxbPL8pcPLtx10lQvyR30t9RbE9LSU7+nP2b1lu6nHmHm5CB8pGsTCi8gKruK87dBfTVtEzkVdTuWTyrWTxjdxT1rk5Tk/NgbPtK/STlTP1npwsqUBGSlZzIAioTeX8BVU1vtFVk+SErFs9qFs+BHUVLPWjajmLG1+wBlIhkJWeRBbRxvUJMrN2zeJavqTuKo7xmD6A8JCsF6S+gl3uF1HgBffbr8QMpP/ied8202j2LZzWasqM4yWv2AIrHq8sF6r/qvPrisL0jF8h1e4U4s/rr41q96nzRIt/zjL8YrB/z+S8Xa/Veda5b6/6gRb5ePDtnrrO0cmuhowwWvGL+/O2HTbk+ob+jaPyrznm+Zg+gOOyslGD5+vz7uKdP03dZ6ly7r2s5Lq5Ffp0OdSbuKBrWfZgW+UC9kKyUKLjZOVhATT5b0ZTaPYtn+S66Dyt7SRnYfZgW+UD9kKyUTCbymAXUmF4hTazds3hWw7QdRVrkA/XFmZWKBOdZnr09fupY1nbVrfunoXYvi6eKOc9SVev+vFvkm0p2FF++ab8+t89X5TxL2a37aZEP1B87KxWTiTP69Flm6/4iW+SbqupynAk9aspWxY4iLfKB5iBZMUSwgJbZur+MFvmmYvGsRlCSc31/RRXYfZgW+UCzkKwYJNwrxLKULGKF9Aqhdv8Fi2c1YncUc+g+TIt8oJk4s2Kg/nmWlbx7hVC7T9aPxdNwzPXi+eNn73R9knMVFz1qlKd8+nhcEpxncW13U1nWTzo5fzDOeRbZtfrqfG7D971Vz3O3eMMHaBZ2VgwW9ArxPbUuX4/bK4TyQ3YD5bgJWvdzv0x2A7dpfynJZd5RpEU+0HwkKzVw7+bCTrCAqhFb95vcIt9ULJ7VuHjFPGPrflrkA9ODMlBNBK866y3zTddxd4e17q9Ti3xTXVyX8Ob4dZZyXN1a5JsqaN3/8y8fH1m2ehht3U+LfGD6sLNSM92nT11SSGq0Rfkhf8PKcXVvkW+quB1FiTMt8oHpQ7JSU5G7b+a6E/nbj/uUH4rD4lm+S7dp+/4JYxuYPiQrNdfvFbJk+eqpb6lr1O6LxeJZDYm7TsyfyAFxxjYwfUhWGkAmctf2HvvK6lB+KAeLJwCUh2QFAAAYjWQFAAAYjWQFAAAYjWQFAAAYjWQFAAAYjWQFAAAYjWQFAAAYjWQFAAAYjWQFAAAYjWQFAAAYjWQFAAAYjWQFAAAYjWQFAAAYjWQFAAAYjWQFAAAYjWQFAAAYjWQFAAAYjWQFAAAYjWQFAAAYjWQFAAAYjWQFAAAYjWQFAAAYjWSlIXzPmrM8718KgFFs2/qdAjARkpWGcDxvTtnW/6masS37fxQqM+M7P+6/+XtLIXf7R0dzB+/a276vHigAEyFZSXP+n9cHb4+ZaArw/N2H2weHv73Sf7ka+nbrxeHHXRbPYrzUcfUdfzf8Pd9SD2ad2TZxz9fLd+2N2bNv2r7vPQp/31HOxovD41UFYCQkK5edhP665VvWPhN5fuRpU+Jp+/YrX/m3Y37KKotnviTmsnh6zuxRQsyFxP0VC+lkJAnXY7ft+d6m/nIu5qe0lLJ2JVFnfAPZkaxELF9fWNITzZYaTFq6C6hM+DLxK4wsWDDlaVMN7qYovYC+1j90Ir+ExTMHEj+JeXTxTIh5SxZSWWzZURyN7FpJAiJJuOrGcYCeS/zHKhRvSRpJyoHsSFZi3L9xddN27SXf95+Evy8Tvp74j1hARyNPmxK3mKfNE9/z1u9dX7yj433H603oYS0Wz/F8KbNZUvYJx7zjud4diblOzOd9T62rmKSFHcVsgnMpeteqHbdrJUnhqZ5Llq8vPkoY492k/OCXj48UgESWQqqXb9otz/HinpY6p+7pnZVbf+woA7x4849V5Tjf6wVoTRnixf/+45p1ZWY7bhKX3avz2ZmdlaX58A5WN96u7W5alvVTzG+5p2O+ZUrMn7/9sCk/SnKrDCGLp04Mt1Vk90r1EsOtezev7kR/zZCYyyHozU8zJ49XlpZOVIVMi/dfDtsPXZVY7nmvk8L1+7euvo5+kBLvjk5vtnRis6cADCBZyejFG72b4lgb6nLSYsQCalKyIgvmV+dzG9HDhUKeNM9cZ23l1nwn7fdIiTeLZwyJ+dfncw+9XswHFk95mj+/4mxGE8Oo7iLquLuWsm7HfNypeiE1Jd6ya6XLPZIQXov5ODEpjDJ9TgFMQhkoo+Vbi3uybd4/zxJ2cZ5Fofu0GfcWhAqVH4YlKiKId1yZgnLcoKQyW/dcypm9dF+XIIYlKuIH/e9F/v0o15eEtxP5uBWU5Ka1NBQ5l3IpUZGk8PSKPZ8lUREpY7w7pxy8/bhNGQ7oIVkZUf88y3zceRaZyKd1AQ3egtDb4jJRXzqXIpNy3Jb4MPduLuxIrT8ab8Xi2S2zJRzq/HIu5bv592pEkcQ8muS0pu1g6LC3qfrnUuazJoVRSWPct9QjDpkDPSQrY+g+gd5YXJUFQQ0+EbWm7bXEtLcgRn3STBLEW5JE/WV08Z3KxVMOdaorTnTxPJEEQ8d8aZzEMCrpoHmfPP0fNX1HMeltqr6RdgvTpIzxVpCUS3KqgCnFmZUcmFB7LvvMSuiMxGb0M3nStM6c9XGe6rNIifeJbdk7P3w7v6VKUMUZipRDnXs6SVkf58k+i5SD5qJTxnmWMuMtO4WO72wk9KWRpPBxkf8cnGcBBrGzkgPZNp+m1xKDcykxicpE5YesUs4PzTW1HJdUZpPEUGIuSWpRiYqQJ3+Jedp5libsKMpOYVrTwmC3sOiEiTNywCCSlZzIZH6/10shep6l5dtquwkLaNC7I+5cSp7lh6ySzg+phi2eSedSdKqyJolhmTGXRVT+PccsorVudBY+l6Iuv/Z9kRSOey5lXJyRA3ooAxWk7G3cIstA3Ttl7NltuUcm5uNCyw9ZDSlTFBLzIssSKWW2bgkirkdN2Yb0Z+lYnnp89+bCROeVwoqK97Nfjx84niWvIrdiPu64vr/+pxuLT1XF6tLzCSgCOysFacJriQNvQUQSlbLKD1kNKVPUqhyXVGazfPVUuqHKYm1KzOVQqF7MV1RcF1zDdxSDnUKdqOyrmPNPwW6hCYmKSBnjU3fIHNOHZKVgdX0tsf8WRFyL/E4V5YesLs4PXS5T1GbxTDqXcvfGwsqkb50UQRbzYedZTFpIg7epUi7T3DMpKYxKGePdpJzzLGgiykAlSukQ2vEsb+3+t+Mv/nmVgVLegjCm/JBV0a378ypLpJTZMndDNcWw1v16d2jns3f6eJy45xHv7k5hTJdfIUmh7/pbJibhSWjdj2lBslKBIs6zTJqspNwpk7lFvqmevT1+4FjxZxKqXDxTW+Qn3J1UF7KI+jPetu/HnnPqjLOQThLvfot8udSxFfOx3Iq8XueFPWmMS+lQj+91zrOg7khWKiSTr23ZD1VkoRrn7ptxk5W0BbOOT5ppUpLETtmLZ68Udfmfpe6JYVTaHU9qxB3FceLd3bVyvtpN65dS56Qwiv4saCrOrFQoqUNoWXffJN0po/ot8k09lzKuoNaf1rpfYqIKFJxLkb+fSmiR35RERUT6hXQiH7fk3EgR51lCh8PbKS3yjT2XMq6UMb5K637UGTsrhpj0tcRRdlakbbd1ZWY7tulVzcsPWQ0pU2R6Ch3lST+lzFZ4N1RTDDvPMmxHMWu8U7r8ivc6KVxvUhKeJGWMdyzfX79ryFtOQBYkK4YZdxs3S7IiC+ZX53MbMTciN678kFVamSKPxTP1XIryH59fcRr1ZJ9FPzGX14WvxXzcSSrJDYv3sBb5dTusnBdKQ2gCykCGSekQOtHFcUHvjphEpZHlh6zSyhSTluOSymxVdUM1Rb9fyNKQV50z36Yd7vKb1iJ/GhMVkTLGL1r3058FpmNnxWCjvJaYtLOS8hbE1JQfshrWkTVajkt60k8ps0liuDYNJYhR9A+aJyXhF0//0Xin7VqJad0tTMOrzqgrkpUaeP5GJxzO5YTDUtbrz+7nNZnIo8lK2lsQ01p+yGpImSJ18UwoszXurZO8DUkUu7dpn3vn3flK4t1/m0rOAMWdSyEpHCJljHfUmbuy/N0f3ivAICQrNZJWe9b/Jjv6UbJ1euX/W5+WV5GLlhLvS4tnyqFO6Ya6xdN9Ni8O23rx9OLa33dJ3xBlWXPT8ipy0TjPgrogWakZeSI6d9xHtrIexnzcUb3FMrpgGnMZWx2llSlk8fSt7kQ/8IRKYjiZIf1ZLmG3cDJJY1wOmf/w7fyWAipGslJTw14D7eNJMycZ4y1q3w3VFN3E3D5fTTnPQlKYo9TzLJSGUDGSlZpL38al/JC3lDIFiWFBuv1CbC96dxK7hQWJG+Ouctf+dP0PewqoCK8u11zQsTLybXm6/yuJSv5sS/2oemW2TuSjuRl7xlefPs0p5OrsintNJyqXDjs7liLWBUgZ40BlSFaa56T3v16vioO3xw8UJiavgEs8Xd+9fdq7IuGvkZ9y0u3LQkvz3ARXE9ieeqh0qSfycYsxnq8MYxyoDMlK85yE7gZp+Za1X8TdK9Mi1HBsV16HTWyeN/Nf13xPrfe+GK2pGQbJK+AH79rbOub7nuf+WWJuK+d1+OfI+GaM5yPzGAcqRLLSQNIh9N6NxVWdtMz3J/QvnSr1QqAwVLBges7skSyY0gF02CHOezcXdsKJosScRXQ0Mkal07Lrnf8rreusr3zG+ITGGeNAVUhWGixIWoK25mXd5lx3wdUEejvcGrVN+0CiqPzXasJrEqZFtASR9TZkxvh4JhnjQBVmFBpPDuHqH/Z+/uXjI8tWD/tlio0stzlPk+AivHPlKt/1VyZ5yvyht41+J3hbSxZRHfNVWpoPuui07PutSbrOMsazyXOMA2ViZ2WKUKaI163Zv/24LzX7c997LDX7vCbxyCVyc7KIyvmAaY+5lCBkt0lKEPrp/q95lSAY4/GKHONAGUhWpgxlii9CC+YrV3l/k9uui+rbIWUNu/eGxRNpFT/Ni2hQgjj33d9LCSLvyzQZ41+UOcaBIpGsTKnuhK6frvq1/pN+maI9LbV++XPK2Qb9526d6ifxrGckJhFeRFWvh8XqNL3qHLyKrEsQD3TJZ+X+9cVHRcacMV7+GAeKwpmVKRfU+vt3g3Rr/Xq7+MfP3ul6E2v9Qc3ek9tkKrqZt3+eZf5L9+He+QrL99fvNvCpt3suxZ7d9n11TZcgSu86yxin3IP6Y2cFXQNlCks9aFqZIq53R9WTeOQ8S+P6hZhWgmCMA/VFsoILTS1TZO3dUZX+Inq5X0iNF9Fnvx4/kBKE73nXTCpBMMaBeqIMhEuaUqaQ7XB5+8H13c6Z6yyt3FroKEP1Y7764rC9I5fI9Vv366+Pa/Wq80UJwtNFCINLEIxxoF5IVpAoUuvf6Jcp9k7d0y2Ta/159e6owvL1+fcqZhE1vV+IlCC+Op/b8H1vVZcgturyZM8YB+qBMhCGSixTGNbWvEntw4PbtIPzLCafr2hCCYIxDpiNZAWZXLQ1V/aSMrCteRPbh0vMYxZRY/qFjNsi31SMccBclIEwEtPKFNPQPjw4z/Ls7fFTx7K2q27d3/QSBGMcMA87KxhL1WWKaWwfLq/9yrZ/v8mZKrt1f1Et8k3FGAfMQbKCsVVRpqB9+JdFtMzW/UW3yDcVYxwwA8kKJhbU+l3fX1EFtjWnffgX4X4hlqVkISukX0jZLfJNxRgHqsWZFeSm//T3NFzrz6OtOe3Dk/XPs6zk3S+k6hb5pmKMA9VgZwW5GyhTTNDWnPbh2QWt+31PrcvX47bupwSRDWMcKBfJCgoRLlOEav2ZyxS0Dx/PvZsLO8EiqkZs3W9qi3xTMcaB8lAGQqEu2si/OX6dpUxB+/DJBTF/+aa96Tru7rDW/XVpkW8qxjhQPJIVlCJoa/7zLx8fWbZ6GG1rTvvw/PUX0TtJ/ULq2iLfVIxxoDiUgVCquDKFvG1C+/DiBOdZ+v1C5roxf/txnxJEMRjjQP5IVlC6cK1ff9lRvn/Cglm8fr+QJctXT31LXWtCi3xTMcaBfJGsoDIyoeun/Sfy1gkLZjkk5q7tPfaV1VnplYlQIMY4kA+SFQAAYDSSFQAAYDSSFQAAYDSSFQAAYDSSFQAAYDSSFQAAYDSSFQAAYDSSFQAAYDSSFQAAYDSSFQAAYDSSFQAAYDSSFQAAYDSSFQAAYDSSFQAAYDSSFQAAYDSSFQAAYDSSFQAAYDSSFQAAYDSSFQAAYDSSFQAAYDSSFQAAYDSSFQAAYDSSFWDK+J41Z3nevxQA1ATJCjAG27Z+p2rK8bw5ZVv/p4AUdR7jaB6SleZpvTj8uLv/5u8thdztHx3NHbxrb/u+ejDwwfl/Xh+8PX6gkDuJuT+jHoa/51jO94zxYiSOcaBCJCsN8OlrdaJ/6IS+tTrrzLZJWvL18l17Y/bsm7bve49iPm75lrVPzPP17NfjBzrmR9GY+8q/zRjPX9IYt1yro4AKkaw0wMrS/Int2nd8338S+UiSllcvDo9XFcb2/N2H23pRbHu+t6m/nAu+rxfM157yH+u/PAn99G6iKJO+PKEqjEVifnD42yvHs/b1l63g+75S7yM/lTGeg7Qxfura8/dvXX2tgAqRrDTED7fmO/duLK7qpGXestTT0Ect/Vy0KxMRZYrRvNRP7LJg2r79SoUWTK3jud6de9cX79y/vvhIx3wpmijKpC87AiyiowlKEBJz2T0JfXTie976vesLS4zx/GQZ4yt6blFAxUhWGkaSlrvfLqwo119Tg6UhyhQZBQump3dI4hbM5esLA0+a4URRRWIeLKLEfLikEoRO/LZOr9jz925e3ZGvGeOTG3WMA1UjWWmo5VuLezLhyESvKFNk9pfD9sPYBVOXe8ILZhxZRCXmcYso5yuSDS1B3Li6KaXO6K9jjI9nkjEOVIVkpeFkoqdMMVx/wTxylScT9cCCqc7sJSn3xC2YcSKLaNjFIqqQWwmCMZ5NnmMcKJulMDVevmm3PMeLLgyic+qe6oXhjx1VsudvP2zKj7LgqArIguk7X+1GtsKFLJhrk26FS8xd2920LOun6O+vl4mt5euLe6pkL978Y1U5zvc6oVpTFZDdjq/O5zZi3qqSEsTWJE/2jPHLih7jQBnYWZkilCm+kAVTdjh0zf4oWrPvn5FYymMSD86zyE6BijnPIjsL01QaKroEwRj/oqwxDpSBZGUKSZlCJqqEMsVR08sUUhaQBTN6RkKTuCSekZiELApxi+i09AspuwTBGC9/jANFIlmZUjJR9Wv985Fa/5xMcHLgsWm1/qB3h+xoqGi/FL3zIWWRoidwWUSlJ06/P0tYt1/IwS8fH6kGiZxLuRb66OJcyvJ38+9VARjj1YxxoAicWUHX8zcfbtuOLRNcK/x9S1mvP7uf14qq9ZdRz5cFU2+Fy5P0auSjTlXnRkRV51nKOLMiJYivz+ceer1yT/jJXkoQj89nZ3bKXjQZ40B9sbOCriaWKcI1ezU4iV/U7KucxIPzLHHnK/r9WWpZGjK1BMEYB+qLZAUDmlKmCO6UiS6Ylq+enrr2kkk1++BVZ99T6yrmjqeDtx+367CI1qUEwRgH6odkBZfIE3+/jXy01t/ybbVtcq0/+U6Z3oJ598bCiqntw+/dXNiJu+PJt9Qjk++/kRKE7ErEtMjv6H/6te61BIa9dcIYB+qFMysY6sUbPWk7ltTDW5GP9k7d061Jav151fOL7N1Rhe55FsfdtZR1O/JRx7O8tfvfjr/453VmxcRzKeNijANmY2cFQ5lepsh6p0yddM+z6B2JuPMssoNR9fmKpBJEv0V+7UoQjHHAbCQryMy0MsW4d8rUiWn33wwrQdT9ll7GOGAmykAYS15linG2yKe1fXherzqPUwaaxhIEYxwwBzsrGEsVZYrQa5rtuPbhTb/WPnjVWQ6FqvhXndtFlCqmtQTBGAfMQbKCiZRVpgjulOlvh18I7pSp6pK4KpR1/w0liB7GOFA9khXkot/WfCla65eJVw5ijlvrD85IxN0pI2ckpvla+6Luv4m0yG+FPuo04VzKuBjjQHU4s4LcSa3fc7zoQic6p+7pnfBroEn1fGr2oxnlPEvSmZXQq8ibkd+j+yoyT/ZfMMaBcrGzgtxNUqbgWvvxBOdZ5ElcxZxnkSf3tNIQJYjRMMaBcrGzgkLtH7XnZk7PH9mWHS1JnOjv7Zx7590xKIthbxvd2laDDcbE3qlrb9GVM7u0Jmf6v/qOrjG0ZGdFShCO72xEn+6lBOG7/haL5nCMcaB4JCsoRUqZonuXibKsORbMfEnMzx33ka2sh9HP5KZh5fsnvqUeRD7quL6//qcbi08VRsIYB4pDsoJSPXt7/MCxuk+WrZSfdqKn8XVui81H2iIaUrsW+aZijAP5I1lBJRLKFCyYBUq//4YSRN4Y40B+SFZQmfATv2yHn7nOGgtm8X7+5eMjy1YPdcw7lCCKxRgHgIaQA4oKpSLm5SLeAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAMMn/D8+rTVwV2u6tAAAAAElFTkSuQmCC\"","\r\n\r\n\r\n","\r\n\r\n\r\n","import Store from '../../../store'\r\nimport API from './api'\r\nimport AdvancedSearch from './advanced-search.vue'\r\n\r\nStore.registerModule('search', {\r\n namespaced: true,\r\n state: {\r\n query: '',\r\n total: 0,\r\n current: 1,\r\n results: [],\r\n pageSize: null,\r\n numberOfResults: 0,\r\n },\r\n mutations: {\r\n search(state, query = '') {\r\n if (!query) {\r\n return\r\n }\r\n API.search({\r\n SearchTerm: query,\r\n PageSize: state.pageSize,\r\n CurrentPage: 1\r\n }).then(data => Object.assign(state, {\r\n query,\r\n total: data.NumberOfPages,\r\n current: 1,\r\n results: data.results,\r\n numberOfResults: data.NumberOfResults\r\n }))\r\n },\r\n paginate(state, current) {\r\n API.search({\r\n SearchTerm: state.query,\r\n PageSize: state.pageSize,\r\n CurrentPage: current,\r\n }).then(data => Object.assign(state, {\r\n current,\r\n results: data.results,\r\n numberOfResults: data.NumberOfResults\r\n }))\r\n }\r\n }\r\n})\r\n\r\nexport default AdvancedSearch\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","\r\n\r\n\r\n\r\n\r\n","/* @preserve\n * Leaflet 1.9.4, a JS library for interactive maps. https://leafletjs.com\n * (c) 2010-2023 Vladimir Agafonkin, (c) 2010-2011 CloudMade\n */\n\n(function (global, factory) {\n typeof exports === 'object' && typeof module !== 'undefined' ? factory(exports) :\n typeof define === 'function' && define.amd ? define(['exports'], factory) :\n (global = typeof globalThis !== 'undefined' ? globalThis : global || self, factory(global.leaflet = {}));\n})(this, (function (exports) { 'use strict';\n\n var version = \"1.9.4\";\n\n /*\r\n * @namespace Util\r\n *\r\n * Various utility functions, used by Leaflet internally.\r\n */\r\n\r\n // @function extend(dest: Object, src?: Object): Object\r\n // Merges the properties of the `src` object (or multiple objects) into `dest` object and returns the latter. Has an `L.extend` shortcut.\r\n function extend(dest) {\r\n \tvar i, j, len, src;\r\n\r\n \tfor (j = 1, len = arguments.length; j < len; j++) {\r\n \t\tsrc = arguments[j];\r\n \t\tfor (i in src) {\r\n \t\t\tdest[i] = src[i];\r\n \t\t}\r\n \t}\r\n \treturn dest;\r\n }\r\n\r\n // @function create(proto: Object, properties?: Object): Object\r\n // Compatibility polyfill for [Object.create](https://developer.mozilla.org/docs/Web/JavaScript/Reference/Global_Objects/Object/create)\r\n var create$2 = Object.create || (function () {\r\n \tfunction F() {}\r\n \treturn function (proto) {\r\n \t\tF.prototype = proto;\r\n \t\treturn new F();\r\n \t};\r\n })();\r\n\r\n // @function bind(fn: Function, …): Function\r\n // Returns a new function bound to the arguments passed, like [Function.prototype.bind](https://developer.mozilla.org/docs/Web/JavaScript/Reference/Global_Objects/Function/bind).\r\n // Has a `L.bind()` shortcut.\r\n function bind(fn, obj) {\r\n \tvar slice = Array.prototype.slice;\r\n\r\n \tif (fn.bind) {\r\n \t\treturn fn.bind.apply(fn, slice.call(arguments, 1));\r\n \t}\r\n\r\n \tvar args = slice.call(arguments, 2);\r\n\r\n \treturn function () {\r\n \t\treturn fn.apply(obj, args.length ? args.concat(slice.call(arguments)) : arguments);\r\n \t};\r\n }\r\n\r\n // @property lastId: Number\r\n // Last unique ID used by [`stamp()`](#util-stamp)\r\n var lastId = 0;\r\n\r\n // @function stamp(obj: Object): Number\r\n // Returns the unique ID of an object, assigning it one if it doesn't have it.\r\n function stamp(obj) {\r\n \tif (!('_leaflet_id' in obj)) {\r\n \t\tobj['_leaflet_id'] = ++lastId;\r\n \t}\r\n \treturn obj._leaflet_id;\r\n }\r\n\r\n // @function throttle(fn: Function, time: Number, context: Object): Function\r\n // Returns a function which executes function `fn` with the given scope `context`\r\n // (so that the `this` keyword refers to `context` inside `fn`'s code). The function\r\n // `fn` will be called no more than one time per given amount of `time`. The arguments\r\n // received by the bound function will be any arguments passed when binding the\r\n // function, followed by any arguments passed when invoking the bound function.\r\n // Has an `L.throttle` shortcut.\r\n function throttle(fn, time, context) {\r\n \tvar lock, args, wrapperFn, later;\r\n\r\n \tlater = function () {\r\n \t\t// reset lock and call if queued\r\n \t\tlock = false;\r\n \t\tif (args) {\r\n \t\t\twrapperFn.apply(context, args);\r\n \t\t\targs = false;\r\n \t\t}\r\n \t};\r\n\r\n \twrapperFn = function () {\r\n \t\tif (lock) {\r\n \t\t\t// called too soon, queue to call later\r\n \t\t\targs = arguments;\r\n\r\n \t\t} else {\r\n \t\t\t// call and lock until later\r\n \t\t\tfn.apply(context, arguments);\r\n \t\t\tsetTimeout(later, time);\r\n \t\t\tlock = true;\r\n \t\t}\r\n \t};\r\n\r\n \treturn wrapperFn;\r\n }\r\n\r\n // @function wrapNum(num: Number, range: Number[], includeMax?: Boolean): Number\r\n // Returns the number `num` modulo `range` in such a way so it lies within\r\n // `range[0]` and `range[1]`. The returned value will be always smaller than\r\n // `range[1]` unless `includeMax` is set to `true`.\r\n function wrapNum(x, range, includeMax) {\r\n \tvar max = range[1],\r\n \t min = range[0],\r\n \t d = max - min;\r\n \treturn x === max && includeMax ? x : ((x - min) % d + d) % d + min;\r\n }\r\n\r\n // @function falseFn(): Function\r\n // Returns a function which always returns `false`.\r\n function falseFn() { return false; }\r\n\r\n // @function formatNum(num: Number, precision?: Number|false): Number\r\n // Returns the number `num` rounded with specified `precision`.\r\n // The default `precision` value is 6 decimal places.\r\n // `false` can be passed to skip any processing (can be useful to avoid round-off errors).\r\n function formatNum(num, precision) {\r\n \tif (precision === false) { return num; }\r\n \tvar pow = Math.pow(10, precision === undefined ? 6 : precision);\r\n \treturn Math.round(num * pow) / pow;\r\n }\r\n\r\n // @function trim(str: String): String\r\n // Compatibility polyfill for [String.prototype.trim](https://developer.mozilla.org/docs/Web/JavaScript/Reference/Global_Objects/String/Trim)\r\n function trim(str) {\r\n \treturn str.trim ? str.trim() : str.replace(/^\\s+|\\s+$/g, '');\r\n }\r\n\r\n // @function splitWords(str: String): String[]\r\n // Trims and splits the string on whitespace and returns the array of parts.\r\n function splitWords(str) {\r\n \treturn trim(str).split(/\\s+/);\r\n }\r\n\r\n // @function setOptions(obj: Object, options: Object): Object\r\n // Merges the given properties to the `options` of the `obj` object, returning the resulting options. See `Class options`. Has an `L.setOptions` shortcut.\r\n function setOptions(obj, options) {\r\n \tif (!Object.prototype.hasOwnProperty.call(obj, 'options')) {\r\n \t\tobj.options = obj.options ? create$2(obj.options) : {};\r\n \t}\r\n \tfor (var i in options) {\r\n \t\tobj.options[i] = options[i];\r\n \t}\r\n \treturn obj.options;\r\n }\r\n\r\n // @function getParamString(obj: Object, existingUrl?: String, uppercase?: Boolean): String\r\n // Converts an object into a parameter URL string, e.g. `{a: \"foo\", b: \"bar\"}`\r\n // translates to `'?a=foo&b=bar'`. If `existingUrl` is set, the parameters will\r\n // be appended at the end. If `uppercase` is `true`, the parameter names will\r\n // be uppercased (e.g. `'?A=foo&B=bar'`)\r\n function getParamString(obj, existingUrl, uppercase) {\r\n \tvar params = [];\r\n \tfor (var i in obj) {\r\n \t\tparams.push(encodeURIComponent(uppercase ? i.toUpperCase() : i) + '=' + encodeURIComponent(obj[i]));\r\n \t}\r\n \treturn ((!existingUrl || existingUrl.indexOf('?') === -1) ? '?' : '&') + params.join('&');\r\n }\r\n\r\n var templateRe = /\\{ *([\\w_ -]+) *\\}/g;\r\n\r\n // @function template(str: String, data: Object): String\r\n // Simple templating facility, accepts a template string of the form `'Hello {a}, {b}'`\r\n // and a data object like `{a: 'foo', b: 'bar'}`, returns evaluated string\r\n // `('Hello foo, bar')`. You can also specify functions instead of strings for\r\n // data values — they will be evaluated passing `data` as an argument.\r\n function template(str, data) {\r\n \treturn str.replace(templateRe, function (str, key) {\r\n \t\tvar value = data[key];\r\n\r\n \t\tif (value === undefined) {\r\n \t\t\tthrow new Error('No value provided for variable ' + str);\r\n\r\n \t\t} else if (typeof value === 'function') {\r\n \t\t\tvalue = value(data);\r\n \t\t}\r\n \t\treturn value;\r\n \t});\r\n }\r\n\r\n // @function isArray(obj): Boolean\r\n // Compatibility polyfill for [Array.isArray](https://developer.mozilla.org/docs/Web/JavaScript/Reference/Global_Objects/Array/isArray)\r\n var isArray = Array.isArray || function (obj) {\r\n \treturn (Object.prototype.toString.call(obj) === '[object Array]');\r\n };\r\n\r\n // @function indexOf(array: Array, el: Object): Number\r\n // Compatibility polyfill for [Array.prototype.indexOf](https://developer.mozilla.org/docs/Web/JavaScript/Reference/Global_Objects/Array/indexOf)\r\n function indexOf(array, el) {\r\n \tfor (var i = 0; i < array.length; i++) {\r\n \t\tif (array[i] === el) { return i; }\r\n \t}\r\n \treturn -1;\r\n }\r\n\r\n // @property emptyImageUrl: String\r\n // Data URI string containing a base64-encoded empty GIF image.\r\n // Used as a hack to free memory from unused images on WebKit-powered\r\n // mobile devices (by setting image `src` to this string).\r\n var emptyImageUrl = 'data:image/gif;base64,R0lGODlhAQABAAD/ACwAAAAAAQABAAACADs=';\r\n\r\n // inspired by https://paulirish.com/2011/requestanimationframe-for-smart-animating/\r\n\r\n function getPrefixed(name) {\r\n \treturn window['webkit' + name] || window['moz' + name] || window['ms' + name];\r\n }\r\n\r\n var lastTime = 0;\r\n\r\n // fallback for IE 7-8\r\n function timeoutDefer(fn) {\r\n \tvar time = +new Date(),\r\n \t timeToCall = Math.max(0, 16 - (time - lastTime));\r\n\r\n \tlastTime = time + timeToCall;\r\n \treturn window.setTimeout(fn, timeToCall);\r\n }\r\n\r\n var requestFn = window.requestAnimationFrame || getPrefixed('RequestAnimationFrame') || timeoutDefer;\r\n var cancelFn = window.cancelAnimationFrame || getPrefixed('CancelAnimationFrame') ||\r\n \t\tgetPrefixed('CancelRequestAnimationFrame') || function (id) { window.clearTimeout(id); };\r\n\r\n // @function requestAnimFrame(fn: Function, context?: Object, immediate?: Boolean): Number\r\n // Schedules `fn` to be executed when the browser repaints. `fn` is bound to\r\n // `context` if given. When `immediate` is set, `fn` is called immediately if\r\n // the browser doesn't have native support for\r\n // [`window.requestAnimationFrame`](https://developer.mozilla.org/docs/Web/API/window/requestAnimationFrame),\r\n // otherwise it's delayed. Returns a request ID that can be used to cancel the request.\r\n function requestAnimFrame(fn, context, immediate) {\r\n \tif (immediate && requestFn === timeoutDefer) {\r\n \t\tfn.call(context);\r\n \t} else {\r\n \t\treturn requestFn.call(window, bind(fn, context));\r\n \t}\r\n }\r\n\r\n // @function cancelAnimFrame(id: Number): undefined\r\n // Cancels a previous `requestAnimFrame`. See also [window.cancelAnimationFrame](https://developer.mozilla.org/docs/Web/API/window/cancelAnimationFrame).\r\n function cancelAnimFrame(id) {\r\n \tif (id) {\r\n \t\tcancelFn.call(window, id);\r\n \t}\r\n }\n\n var Util = {\n __proto__: null,\n extend: extend,\n create: create$2,\n bind: bind,\n get lastId () { return lastId; },\n stamp: stamp,\n throttle: throttle,\n wrapNum: wrapNum,\n falseFn: falseFn,\n formatNum: formatNum,\n trim: trim,\n splitWords: splitWords,\n setOptions: setOptions,\n getParamString: getParamString,\n template: template,\n isArray: isArray,\n indexOf: indexOf,\n emptyImageUrl: emptyImageUrl,\n requestFn: requestFn,\n cancelFn: cancelFn,\n requestAnimFrame: requestAnimFrame,\n cancelAnimFrame: cancelAnimFrame\n };\n\n // @class Class\r\n // @aka L.Class\r\n\r\n // @section\r\n // @uninheritable\r\n\r\n // Thanks to John Resig and Dean Edwards for inspiration!\r\n\r\n function Class() {}\r\n\r\n Class.extend = function (props) {\r\n\r\n \t// @function extend(props: Object): Function\r\n \t// [Extends the current class](#class-inheritance) given the properties to be included.\r\n \t// Returns a Javascript function that is a class constructor (to be called with `new`).\r\n \tvar NewClass = function () {\r\n\r\n \t\tsetOptions(this);\r\n\r\n \t\t// call the constructor\r\n \t\tif (this.initialize) {\r\n \t\t\tthis.initialize.apply(this, arguments);\r\n \t\t}\r\n\r\n \t\t// call all constructor hooks\r\n \t\tthis.callInitHooks();\r\n \t};\r\n\r\n \tvar parentProto = NewClass.__super__ = this.prototype;\r\n\r\n \tvar proto = create$2(parentProto);\r\n \tproto.constructor = NewClass;\r\n\r\n \tNewClass.prototype = proto;\r\n\r\n \t// inherit parent's statics\r\n \tfor (var i in this) {\r\n \t\tif (Object.prototype.hasOwnProperty.call(this, i) && i !== 'prototype' && i !== '__super__') {\r\n \t\t\tNewClass[i] = this[i];\r\n \t\t}\r\n \t}\r\n\r\n \t// mix static properties into the class\r\n \tif (props.statics) {\r\n \t\textend(NewClass, props.statics);\r\n \t}\r\n\r\n \t// mix includes into the prototype\r\n \tif (props.includes) {\r\n \t\tcheckDeprecatedMixinEvents(props.includes);\r\n \t\textend.apply(null, [proto].concat(props.includes));\r\n \t}\r\n\r\n \t// mix given properties into the prototype\r\n \textend(proto, props);\r\n \tdelete proto.statics;\r\n \tdelete proto.includes;\r\n\r\n \t// merge options\r\n \tif (proto.options) {\r\n \t\tproto.options = parentProto.options ? create$2(parentProto.options) : {};\r\n \t\textend(proto.options, props.options);\r\n \t}\r\n\r\n \tproto._initHooks = [];\r\n\r\n \t// add method for calling all hooks\r\n \tproto.callInitHooks = function () {\r\n\r\n \t\tif (this._initHooksCalled) { return; }\r\n\r\n \t\tif (parentProto.callInitHooks) {\r\n \t\t\tparentProto.callInitHooks.call(this);\r\n \t\t}\r\n\r\n \t\tthis._initHooksCalled = true;\r\n\r\n \t\tfor (var i = 0, len = proto._initHooks.length; i < len; i++) {\r\n \t\t\tproto._initHooks[i].call(this);\r\n \t\t}\r\n \t};\r\n\r\n \treturn NewClass;\r\n };\r\n\r\n\r\n // @function include(properties: Object): this\r\n // [Includes a mixin](#class-includes) into the current class.\r\n Class.include = function (props) {\r\n \tvar parentOptions = this.prototype.options;\r\n \textend(this.prototype, props);\r\n \tif (props.options) {\r\n \t\tthis.prototype.options = parentOptions;\r\n \t\tthis.mergeOptions(props.options);\r\n \t}\r\n \treturn this;\r\n };\r\n\r\n // @function mergeOptions(options: Object): this\r\n // [Merges `options`](#class-options) into the defaults of the class.\r\n Class.mergeOptions = function (options) {\r\n \textend(this.prototype.options, options);\r\n \treturn this;\r\n };\r\n\r\n // @function addInitHook(fn: Function): this\r\n // Adds a [constructor hook](#class-constructor-hooks) to the class.\r\n Class.addInitHook = function (fn) { // (Function) || (String, args...)\r\n \tvar args = Array.prototype.slice.call(arguments, 1);\r\n\r\n \tvar init = typeof fn === 'function' ? fn : function () {\r\n \t\tthis[fn].apply(this, args);\r\n \t};\r\n\r\n \tthis.prototype._initHooks = this.prototype._initHooks || [];\r\n \tthis.prototype._initHooks.push(init);\r\n \treturn this;\r\n };\r\n\r\n function checkDeprecatedMixinEvents(includes) {\r\n \t/* global L: true */\r\n \tif (typeof L === 'undefined' || !L || !L.Mixin) { return; }\r\n\r\n \tincludes = isArray(includes) ? includes : [includes];\r\n\r\n \tfor (var i = 0; i < includes.length; i++) {\r\n \t\tif (includes[i] === L.Mixin.Events) {\r\n \t\t\tconsole.warn('Deprecated include of L.Mixin.Events: ' +\r\n \t\t\t\t'this property will be removed in future releases, ' +\r\n \t\t\t\t'please inherit from L.Evented instead.', new Error().stack);\r\n \t\t}\r\n \t}\r\n }\n\n /*\r\n * @class Evented\r\n * @aka L.Evented\r\n * @inherits Class\r\n *\r\n * A set of methods shared between event-powered classes (like `Map` and `Marker`). Generally, events allow you to execute some function when something happens with an object (e.g. the user clicks on the map, causing the map to fire `'click'` event).\r\n *\r\n * @example\r\n *\r\n * ```js\r\n * map.on('click', function(e) {\r\n * \talert(e.latlng);\r\n * } );\r\n * ```\r\n *\r\n * Leaflet deals with event listeners by reference, so if you want to add a listener and then remove it, define it as a function:\r\n *\r\n * ```js\r\n * function onClick(e) { ... }\r\n *\r\n * map.on('click', onClick);\r\n * map.off('click', onClick);\r\n * ```\r\n */\r\n\r\n var Events = {\r\n \t/* @method on(type: String, fn: Function, context?: Object): this\r\n \t * Adds a listener function (`fn`) to a particular event type of the object. You can optionally specify the context of the listener (object the this keyword will point to). You can also pass several space-separated types (e.g. `'click dblclick'`).\r\n \t *\r\n \t * @alternative\r\n \t * @method on(eventMap: Object): this\r\n \t * Adds a set of type/listener pairs, e.g. `{click: onClick, mousemove: onMouseMove}`\r\n \t */\r\n \ton: function (types, fn, context) {\r\n\r\n \t\t// types can be a map of types/handlers\r\n \t\tif (typeof types === 'object') {\r\n \t\t\tfor (var type in types) {\r\n \t\t\t\t// we don't process space-separated events here for performance;\r\n \t\t\t\t// it's a hot path since Layer uses the on(obj) syntax\r\n \t\t\t\tthis._on(type, types[type], fn);\r\n \t\t\t}\r\n\r\n \t\t} else {\r\n \t\t\t// types can be a string of space-separated words\r\n \t\t\ttypes = splitWords(types);\r\n\r\n \t\t\tfor (var i = 0, len = types.length; i < len; i++) {\r\n \t\t\t\tthis._on(types[i], fn, context);\r\n \t\t\t}\r\n \t\t}\r\n\r\n \t\treturn this;\r\n \t},\r\n\r\n \t/* @method off(type: String, fn?: Function, context?: Object): this\r\n \t * Removes a previously added listener function. If no function is specified, it will remove all the listeners of that particular event from the object. Note that if you passed a custom context to `on`, you must pass the same context to `off` in order to remove the listener.\r\n \t *\r\n \t * @alternative\r\n \t * @method off(eventMap: Object): this\r\n \t * Removes a set of type/listener pairs.\r\n \t *\r\n \t * @alternative\r\n \t * @method off: this\r\n \t * Removes all listeners to all events on the object. This includes implicitly attached events.\r\n \t */\r\n \toff: function (types, fn, context) {\r\n\r\n \t\tif (!arguments.length) {\r\n \t\t\t// clear all listeners if called without arguments\r\n \t\t\tdelete this._events;\r\n\r\n \t\t} else if (typeof types === 'object') {\r\n \t\t\tfor (var type in types) {\r\n \t\t\t\tthis._off(type, types[type], fn);\r\n \t\t\t}\r\n\r\n \t\t} else {\r\n \t\t\ttypes = splitWords(types);\r\n\r\n \t\t\tvar removeAll = arguments.length === 1;\r\n \t\t\tfor (var i = 0, len = types.length; i < len; i++) {\r\n \t\t\t\tif (removeAll) {\r\n \t\t\t\t\tthis._off(types[i]);\r\n \t\t\t\t} else {\r\n \t\t\t\t\tthis._off(types[i], fn, context);\r\n \t\t\t\t}\r\n \t\t\t}\r\n \t\t}\r\n\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// attach listener (without syntactic sugar now)\r\n \t_on: function (type, fn, context, _once) {\r\n \t\tif (typeof fn !== 'function') {\r\n \t\t\tconsole.warn('wrong listener type: ' + typeof fn);\r\n \t\t\treturn;\r\n \t\t}\r\n\r\n \t\t// check if fn already there\r\n \t\tif (this._listens(type, fn, context) !== false) {\r\n \t\t\treturn;\r\n \t\t}\r\n\r\n \t\tif (context === this) {\r\n \t\t\t// Less memory footprint.\r\n \t\t\tcontext = undefined;\r\n \t\t}\r\n\r\n \t\tvar newListener = {fn: fn, ctx: context};\r\n \t\tif (_once) {\r\n \t\t\tnewListener.once = true;\r\n \t\t}\r\n\r\n \t\tthis._events = this._events || {};\r\n \t\tthis._events[type] = this._events[type] || [];\r\n \t\tthis._events[type].push(newListener);\r\n \t},\r\n\r\n \t_off: function (type, fn, context) {\r\n \t\tvar listeners,\r\n \t\t i,\r\n \t\t len;\r\n\r\n \t\tif (!this._events) {\r\n \t\t\treturn;\r\n \t\t}\r\n\r\n \t\tlisteners = this._events[type];\r\n \t\tif (!listeners) {\r\n \t\t\treturn;\r\n \t\t}\r\n\r\n \t\tif (arguments.length === 1) { // remove all\r\n \t\t\tif (this._firingCount) {\r\n \t\t\t\t// Set all removed listeners to noop\r\n \t\t\t\t// so they are not called if remove happens in fire\r\n \t\t\t\tfor (i = 0, len = listeners.length; i < len; i++) {\r\n \t\t\t\t\tlisteners[i].fn = falseFn;\r\n \t\t\t\t}\r\n \t\t\t}\r\n \t\t\t// clear all listeners for a type if function isn't specified\r\n \t\t\tdelete this._events[type];\r\n \t\t\treturn;\r\n \t\t}\r\n\r\n \t\tif (typeof fn !== 'function') {\r\n \t\t\tconsole.warn('wrong listener type: ' + typeof fn);\r\n \t\t\treturn;\r\n \t\t}\r\n\r\n \t\t// find fn and remove it\r\n \t\tvar index = this._listens(type, fn, context);\r\n \t\tif (index !== false) {\r\n \t\t\tvar listener = listeners[index];\r\n \t\t\tif (this._firingCount) {\r\n \t\t\t\t// set the removed listener to noop so that's not called if remove happens in fire\r\n \t\t\t\tlistener.fn = falseFn;\r\n\r\n \t\t\t\t/* copy array in case events are being fired */\r\n \t\t\t\tthis._events[type] = listeners = listeners.slice();\r\n \t\t\t}\r\n \t\t\tlisteners.splice(index, 1);\r\n \t\t}\r\n \t},\r\n\r\n \t// @method fire(type: String, data?: Object, propagate?: Boolean): this\r\n \t// Fires an event of the specified type. You can optionally provide a data\r\n \t// object — the first argument of the listener function will contain its\r\n \t// properties. The event can optionally be propagated to event parents.\r\n \tfire: function (type, data, propagate) {\r\n \t\tif (!this.listens(type, propagate)) { return this; }\r\n\r\n \t\tvar event = extend({}, data, {\r\n \t\t\ttype: type,\r\n \t\t\ttarget: this,\r\n \t\t\tsourceTarget: data && data.sourceTarget || this\r\n \t\t});\r\n\r\n \t\tif (this._events) {\r\n \t\t\tvar listeners = this._events[type];\r\n \t\t\tif (listeners) {\r\n \t\t\t\tthis._firingCount = (this._firingCount + 1) || 1;\r\n \t\t\t\tfor (var i = 0, len = listeners.length; i < len; i++) {\r\n \t\t\t\t\tvar l = listeners[i];\r\n \t\t\t\t\t// off overwrites l.fn, so we need to copy fn to a var\r\n \t\t\t\t\tvar fn = l.fn;\r\n \t\t\t\t\tif (l.once) {\r\n \t\t\t\t\t\tthis.off(type, fn, l.ctx);\r\n \t\t\t\t\t}\r\n \t\t\t\t\tfn.call(l.ctx || this, event);\r\n \t\t\t\t}\r\n\r\n \t\t\t\tthis._firingCount--;\r\n \t\t\t}\r\n \t\t}\r\n\r\n \t\tif (propagate) {\r\n \t\t\t// propagate the event to parents (set with addEventParent)\r\n \t\t\tthis._propagateEvent(event);\r\n \t\t}\r\n\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method listens(type: String, propagate?: Boolean): Boolean\r\n \t// @method listens(type: String, fn: Function, context?: Object, propagate?: Boolean): Boolean\r\n \t// Returns `true` if a particular event type has any listeners attached to it.\r\n \t// The verification can optionally be propagated, it will return `true` if parents have the listener attached to it.\r\n \tlistens: function (type, fn, context, propagate) {\r\n \t\tif (typeof type !== 'string') {\r\n \t\t\tconsole.warn('\"string\" type argument expected');\r\n \t\t}\r\n\r\n \t\t// we don't overwrite the input `fn` value, because we need to use it for propagation\r\n \t\tvar _fn = fn;\r\n \t\tif (typeof fn !== 'function') {\r\n \t\t\tpropagate = !!fn;\r\n \t\t\t_fn = undefined;\r\n \t\t\tcontext = undefined;\r\n \t\t}\r\n\r\n \t\tvar listeners = this._events && this._events[type];\r\n \t\tif (listeners && listeners.length) {\r\n \t\t\tif (this._listens(type, _fn, context) !== false) {\r\n \t\t\t\treturn true;\r\n \t\t\t}\r\n \t\t}\r\n\r\n \t\tif (propagate) {\r\n \t\t\t// also check parents for listeners if event propagates\r\n \t\t\tfor (var id in this._eventParents) {\r\n \t\t\t\tif (this._eventParents[id].listens(type, fn, context, propagate)) { return true; }\r\n \t\t\t}\r\n \t\t}\r\n \t\treturn false;\r\n \t},\r\n\r\n \t// returns the index (number) or false\r\n \t_listens: function (type, fn, context) {\r\n \t\tif (!this._events) {\r\n \t\t\treturn false;\r\n \t\t}\r\n\r\n \t\tvar listeners = this._events[type] || [];\r\n \t\tif (!fn) {\r\n \t\t\treturn !!listeners.length;\r\n \t\t}\r\n\r\n \t\tif (context === this) {\r\n \t\t\t// Less memory footprint.\r\n \t\t\tcontext = undefined;\r\n \t\t}\r\n\r\n \t\tfor (var i = 0, len = listeners.length; i < len; i++) {\r\n \t\t\tif (listeners[i].fn === fn && listeners[i].ctx === context) {\r\n \t\t\t\treturn i;\r\n \t\t\t}\r\n \t\t}\r\n \t\treturn false;\r\n\r\n \t},\r\n\r\n \t// @method once(…): this\r\n \t// Behaves as [`on(…)`](#evented-on), except the listener will only get fired once and then removed.\r\n \tonce: function (types, fn, context) {\r\n\r\n \t\t// types can be a map of types/handlers\r\n \t\tif (typeof types === 'object') {\r\n \t\t\tfor (var type in types) {\r\n \t\t\t\t// we don't process space-separated events here for performance;\r\n \t\t\t\t// it's a hot path since Layer uses the on(obj) syntax\r\n \t\t\t\tthis._on(type, types[type], fn, true);\r\n \t\t\t}\r\n\r\n \t\t} else {\r\n \t\t\t// types can be a string of space-separated words\r\n \t\t\ttypes = splitWords(types);\r\n\r\n \t\t\tfor (var i = 0, len = types.length; i < len; i++) {\r\n \t\t\t\tthis._on(types[i], fn, context, true);\r\n \t\t\t}\r\n \t\t}\r\n\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method addEventParent(obj: Evented): this\r\n \t// Adds an event parent - an `Evented` that will receive propagated events\r\n \taddEventParent: function (obj) {\r\n \t\tthis._eventParents = this._eventParents || {};\r\n \t\tthis._eventParents[stamp(obj)] = obj;\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method removeEventParent(obj: Evented): this\r\n \t// Removes an event parent, so it will stop receiving propagated events\r\n \tremoveEventParent: function (obj) {\r\n \t\tif (this._eventParents) {\r\n \t\t\tdelete this._eventParents[stamp(obj)];\r\n \t\t}\r\n \t\treturn this;\r\n \t},\r\n\r\n \t_propagateEvent: function (e) {\r\n \t\tfor (var id in this._eventParents) {\r\n \t\t\tthis._eventParents[id].fire(e.type, extend({\r\n \t\t\t\tlayer: e.target,\r\n \t\t\t\tpropagatedFrom: e.target\r\n \t\t\t}, e), true);\r\n \t\t}\r\n \t}\r\n };\r\n\r\n // aliases; we should ditch those eventually\r\n\r\n // @method addEventListener(…): this\r\n // Alias to [`on(…)`](#evented-on)\r\n Events.addEventListener = Events.on;\r\n\r\n // @method removeEventListener(…): this\r\n // Alias to [`off(…)`](#evented-off)\r\n\r\n // @method clearAllEventListeners(…): this\r\n // Alias to [`off()`](#evented-off)\r\n Events.removeEventListener = Events.clearAllEventListeners = Events.off;\r\n\r\n // @method addOneTimeEventListener(…): this\r\n // Alias to [`once(…)`](#evented-once)\r\n Events.addOneTimeEventListener = Events.once;\r\n\r\n // @method fireEvent(…): this\r\n // Alias to [`fire(…)`](#evented-fire)\r\n Events.fireEvent = Events.fire;\r\n\r\n // @method hasEventListeners(…): Boolean\r\n // Alias to [`listens(…)`](#evented-listens)\r\n Events.hasEventListeners = Events.listens;\r\n\r\n var Evented = Class.extend(Events);\n\n /*\r\n * @class Point\r\n * @aka L.Point\r\n *\r\n * Represents a point with `x` and `y` coordinates in pixels.\r\n *\r\n * @example\r\n *\r\n * ```js\r\n * var point = L.point(200, 300);\r\n * ```\r\n *\r\n * All Leaflet methods and options that accept `Point` objects also accept them in a simple Array form (unless noted otherwise), so these lines are equivalent:\r\n *\r\n * ```js\r\n * map.panBy([200, 300]);\r\n * map.panBy(L.point(200, 300));\r\n * ```\r\n *\r\n * Note that `Point` does not inherit from Leaflet's `Class` object,\r\n * which means new classes can't inherit from it, and new methods\r\n * can't be added to it with the `include` function.\r\n */\r\n\r\n function Point(x, y, round) {\r\n \t// @property x: Number; The `x` coordinate of the point\r\n \tthis.x = (round ? Math.round(x) : x);\r\n \t// @property y: Number; The `y` coordinate of the point\r\n \tthis.y = (round ? Math.round(y) : y);\r\n }\r\n\r\n var trunc = Math.trunc || function (v) {\r\n \treturn v > 0 ? Math.floor(v) : Math.ceil(v);\r\n };\r\n\r\n Point.prototype = {\r\n\r\n \t// @method clone(): Point\r\n \t// Returns a copy of the current point.\r\n \tclone: function () {\r\n \t\treturn new Point(this.x, this.y);\r\n \t},\r\n\r\n \t// @method add(otherPoint: Point): Point\r\n \t// Returns the result of addition of the current and the given points.\r\n \tadd: function (point) {\r\n \t\t// non-destructive, returns a new point\r\n \t\treturn this.clone()._add(toPoint(point));\r\n \t},\r\n\r\n \t_add: function (point) {\r\n \t\t// destructive, used directly for performance in situations where it's safe to modify existing point\r\n \t\tthis.x += point.x;\r\n \t\tthis.y += point.y;\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method subtract(otherPoint: Point): Point\r\n \t// Returns the result of subtraction of the given point from the current.\r\n \tsubtract: function (point) {\r\n \t\treturn this.clone()._subtract(toPoint(point));\r\n \t},\r\n\r\n \t_subtract: function (point) {\r\n \t\tthis.x -= point.x;\r\n \t\tthis.y -= point.y;\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method divideBy(num: Number): Point\r\n \t// Returns the result of division of the current point by the given number.\r\n \tdivideBy: function (num) {\r\n \t\treturn this.clone()._divideBy(num);\r\n \t},\r\n\r\n \t_divideBy: function (num) {\r\n \t\tthis.x /= num;\r\n \t\tthis.y /= num;\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method multiplyBy(num: Number): Point\r\n \t// Returns the result of multiplication of the current point by the given number.\r\n \tmultiplyBy: function (num) {\r\n \t\treturn this.clone()._multiplyBy(num);\r\n \t},\r\n\r\n \t_multiplyBy: function (num) {\r\n \t\tthis.x *= num;\r\n \t\tthis.y *= num;\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method scaleBy(scale: Point): Point\r\n \t// Multiply each coordinate of the current point by each coordinate of\r\n \t// `scale`. In linear algebra terms, multiply the point by the\r\n \t// [scaling matrix](https://en.wikipedia.org/wiki/Scaling_%28geometry%29#Matrix_representation)\r\n \t// defined by `scale`.\r\n \tscaleBy: function (point) {\r\n \t\treturn new Point(this.x * point.x, this.y * point.y);\r\n \t},\r\n\r\n \t// @method unscaleBy(scale: Point): Point\r\n \t// Inverse of `scaleBy`. Divide each coordinate of the current point by\r\n \t// each coordinate of `scale`.\r\n \tunscaleBy: function (point) {\r\n \t\treturn new Point(this.x / point.x, this.y / point.y);\r\n \t},\r\n\r\n \t// @method round(): Point\r\n \t// Returns a copy of the current point with rounded coordinates.\r\n \tround: function () {\r\n \t\treturn this.clone()._round();\r\n \t},\r\n\r\n \t_round: function () {\r\n \t\tthis.x = Math.round(this.x);\r\n \t\tthis.y = Math.round(this.y);\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method floor(): Point\r\n \t// Returns a copy of the current point with floored coordinates (rounded down).\r\n \tfloor: function () {\r\n \t\treturn this.clone()._floor();\r\n \t},\r\n\r\n \t_floor: function () {\r\n \t\tthis.x = Math.floor(this.x);\r\n \t\tthis.y = Math.floor(this.y);\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method ceil(): Point\r\n \t// Returns a copy of the current point with ceiled coordinates (rounded up).\r\n \tceil: function () {\r\n \t\treturn this.clone()._ceil();\r\n \t},\r\n\r\n \t_ceil: function () {\r\n \t\tthis.x = Math.ceil(this.x);\r\n \t\tthis.y = Math.ceil(this.y);\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method trunc(): Point\r\n \t// Returns a copy of the current point with truncated coordinates (rounded towards zero).\r\n \ttrunc: function () {\r\n \t\treturn this.clone()._trunc();\r\n \t},\r\n\r\n \t_trunc: function () {\r\n \t\tthis.x = trunc(this.x);\r\n \t\tthis.y = trunc(this.y);\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method distanceTo(otherPoint: Point): Number\r\n \t// Returns the cartesian distance between the current and the given points.\r\n \tdistanceTo: function (point) {\r\n \t\tpoint = toPoint(point);\r\n\r\n \t\tvar x = point.x - this.x,\r\n \t\t y = point.y - this.y;\r\n\r\n \t\treturn Math.sqrt(x * x + y * y);\r\n \t},\r\n\r\n \t// @method equals(otherPoint: Point): Boolean\r\n \t// Returns `true` if the given point has the same coordinates.\r\n \tequals: function (point) {\r\n \t\tpoint = toPoint(point);\r\n\r\n \t\treturn point.x === this.x &&\r\n \t\t point.y === this.y;\r\n \t},\r\n\r\n \t// @method contains(otherPoint: Point): Boolean\r\n \t// Returns `true` if both coordinates of the given point are less than the corresponding current point coordinates (in absolute values).\r\n \tcontains: function (point) {\r\n \t\tpoint = toPoint(point);\r\n\r\n \t\treturn Math.abs(point.x) <= Math.abs(this.x) &&\r\n \t\t Math.abs(point.y) <= Math.abs(this.y);\r\n \t},\r\n\r\n \t// @method toString(): String\r\n \t// Returns a string representation of the point for debugging purposes.\r\n \ttoString: function () {\r\n \t\treturn 'Point(' +\r\n \t\t formatNum(this.x) + ', ' +\r\n \t\t formatNum(this.y) + ')';\r\n \t}\r\n };\r\n\r\n // @factory L.point(x: Number, y: Number, round?: Boolean)\r\n // Creates a Point object with the given `x` and `y` coordinates. If optional `round` is set to true, rounds the `x` and `y` values.\r\n\r\n // @alternative\r\n // @factory L.point(coords: Number[])\r\n // Expects an array of the form `[x, y]` instead.\r\n\r\n // @alternative\r\n // @factory L.point(coords: Object)\r\n // Expects a plain object of the form `{x: Number, y: Number}` instead.\r\n function toPoint(x, y, round) {\r\n \tif (x instanceof Point) {\r\n \t\treturn x;\r\n \t}\r\n \tif (isArray(x)) {\r\n \t\treturn new Point(x[0], x[1]);\r\n \t}\r\n \tif (x === undefined || x === null) {\r\n \t\treturn x;\r\n \t}\r\n \tif (typeof x === 'object' && 'x' in x && 'y' in x) {\r\n \t\treturn new Point(x.x, x.y);\r\n \t}\r\n \treturn new Point(x, y, round);\r\n }\n\n /*\r\n * @class Bounds\r\n * @aka L.Bounds\r\n *\r\n * Represents a rectangular area in pixel coordinates.\r\n *\r\n * @example\r\n *\r\n * ```js\r\n * var p1 = L.point(10, 10),\r\n * p2 = L.point(40, 60),\r\n * bounds = L.bounds(p1, p2);\r\n * ```\r\n *\r\n * All Leaflet methods that accept `Bounds` objects also accept them in a simple Array form (unless noted otherwise), so the bounds example above can be passed like this:\r\n *\r\n * ```js\r\n * otherBounds.intersects([[10, 10], [40, 60]]);\r\n * ```\r\n *\r\n * Note that `Bounds` does not inherit from Leaflet's `Class` object,\r\n * which means new classes can't inherit from it, and new methods\r\n * can't be added to it with the `include` function.\r\n */\r\n\r\n function Bounds(a, b) {\r\n \tif (!a) { return; }\r\n\r\n \tvar points = b ? [a, b] : a;\r\n\r\n \tfor (var i = 0, len = points.length; i < len; i++) {\r\n \t\tthis.extend(points[i]);\r\n \t}\r\n }\r\n\r\n Bounds.prototype = {\r\n \t// @method extend(point: Point): this\r\n \t// Extends the bounds to contain the given point.\r\n\r\n \t// @alternative\r\n \t// @method extend(otherBounds: Bounds): this\r\n \t// Extend the bounds to contain the given bounds\r\n \textend: function (obj) {\r\n \t\tvar min2, max2;\r\n \t\tif (!obj) { return this; }\r\n\r\n \t\tif (obj instanceof Point || typeof obj[0] === 'number' || 'x' in obj) {\r\n \t\t\tmin2 = max2 = toPoint(obj);\r\n \t\t} else {\r\n \t\t\tobj = toBounds(obj);\r\n \t\t\tmin2 = obj.min;\r\n \t\t\tmax2 = obj.max;\r\n\r\n \t\t\tif (!min2 || !max2) { return this; }\r\n \t\t}\r\n\r\n \t\t// @property min: Point\r\n \t\t// The top left corner of the rectangle.\r\n \t\t// @property max: Point\r\n \t\t// The bottom right corner of the rectangle.\r\n \t\tif (!this.min && !this.max) {\r\n \t\t\tthis.min = min2.clone();\r\n \t\t\tthis.max = max2.clone();\r\n \t\t} else {\r\n \t\t\tthis.min.x = Math.min(min2.x, this.min.x);\r\n \t\t\tthis.max.x = Math.max(max2.x, this.max.x);\r\n \t\t\tthis.min.y = Math.min(min2.y, this.min.y);\r\n \t\t\tthis.max.y = Math.max(max2.y, this.max.y);\r\n \t\t}\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method getCenter(round?: Boolean): Point\r\n \t// Returns the center point of the bounds.\r\n \tgetCenter: function (round) {\r\n \t\treturn toPoint(\r\n \t\t (this.min.x + this.max.x) / 2,\r\n \t\t (this.min.y + this.max.y) / 2, round);\r\n \t},\r\n\r\n \t// @method getBottomLeft(): Point\r\n \t// Returns the bottom-left point of the bounds.\r\n \tgetBottomLeft: function () {\r\n \t\treturn toPoint(this.min.x, this.max.y);\r\n \t},\r\n\r\n \t// @method getTopRight(): Point\r\n \t// Returns the top-right point of the bounds.\r\n \tgetTopRight: function () { // -> Point\r\n \t\treturn toPoint(this.max.x, this.min.y);\r\n \t},\r\n\r\n \t// @method getTopLeft(): Point\r\n \t// Returns the top-left point of the bounds (i.e. [`this.min`](#bounds-min)).\r\n \tgetTopLeft: function () {\r\n \t\treturn this.min; // left, top\r\n \t},\r\n\r\n \t// @method getBottomRight(): Point\r\n \t// Returns the bottom-right point of the bounds (i.e. [`this.max`](#bounds-max)).\r\n \tgetBottomRight: function () {\r\n \t\treturn this.max; // right, bottom\r\n \t},\r\n\r\n \t// @method getSize(): Point\r\n \t// Returns the size of the given bounds\r\n \tgetSize: function () {\r\n \t\treturn this.max.subtract(this.min);\r\n \t},\r\n\r\n \t// @method contains(otherBounds: Bounds): Boolean\r\n \t// Returns `true` if the rectangle contains the given one.\r\n \t// @alternative\r\n \t// @method contains(point: Point): Boolean\r\n \t// Returns `true` if the rectangle contains the given point.\r\n \tcontains: function (obj) {\r\n \t\tvar min, max;\r\n\r\n \t\tif (typeof obj[0] === 'number' || obj instanceof Point) {\r\n \t\t\tobj = toPoint(obj);\r\n \t\t} else {\r\n \t\t\tobj = toBounds(obj);\r\n \t\t}\r\n\r\n \t\tif (obj instanceof Bounds) {\r\n \t\t\tmin = obj.min;\r\n \t\t\tmax = obj.max;\r\n \t\t} else {\r\n \t\t\tmin = max = obj;\r\n \t\t}\r\n\r\n \t\treturn (min.x >= this.min.x) &&\r\n \t\t (max.x <= this.max.x) &&\r\n \t\t (min.y >= this.min.y) &&\r\n \t\t (max.y <= this.max.y);\r\n \t},\r\n\r\n \t// @method intersects(otherBounds: Bounds): Boolean\r\n \t// Returns `true` if the rectangle intersects the given bounds. Two bounds\r\n \t// intersect if they have at least one point in common.\r\n \tintersects: function (bounds) { // (Bounds) -> Boolean\r\n \t\tbounds = toBounds(bounds);\r\n\r\n \t\tvar min = this.min,\r\n \t\t max = this.max,\r\n \t\t min2 = bounds.min,\r\n \t\t max2 = bounds.max,\r\n \t\t xIntersects = (max2.x >= min.x) && (min2.x <= max.x),\r\n \t\t yIntersects = (max2.y >= min.y) && (min2.y <= max.y);\r\n\r\n \t\treturn xIntersects && yIntersects;\r\n \t},\r\n\r\n \t// @method overlaps(otherBounds: Bounds): Boolean\r\n \t// Returns `true` if the rectangle overlaps the given bounds. Two bounds\r\n \t// overlap if their intersection is an area.\r\n \toverlaps: function (bounds) { // (Bounds) -> Boolean\r\n \t\tbounds = toBounds(bounds);\r\n\r\n \t\tvar min = this.min,\r\n \t\t max = this.max,\r\n \t\t min2 = bounds.min,\r\n \t\t max2 = bounds.max,\r\n \t\t xOverlaps = (max2.x > min.x) && (min2.x < max.x),\r\n \t\t yOverlaps = (max2.y > min.y) && (min2.y < max.y);\r\n\r\n \t\treturn xOverlaps && yOverlaps;\r\n \t},\r\n\r\n \t// @method isValid(): Boolean\r\n \t// Returns `true` if the bounds are properly initialized.\r\n \tisValid: function () {\r\n \t\treturn !!(this.min && this.max);\r\n \t},\r\n\r\n\r\n \t// @method pad(bufferRatio: Number): Bounds\r\n \t// Returns bounds created by extending or retracting the current bounds by a given ratio in each direction.\r\n \t// For example, a ratio of 0.5 extends the bounds by 50% in each direction.\r\n \t// Negative values will retract the bounds.\r\n \tpad: function (bufferRatio) {\r\n \t\tvar min = this.min,\r\n \t\tmax = this.max,\r\n \t\theightBuffer = Math.abs(min.x - max.x) * bufferRatio,\r\n \t\twidthBuffer = Math.abs(min.y - max.y) * bufferRatio;\r\n\r\n\r\n \t\treturn toBounds(\r\n \t\t\ttoPoint(min.x - heightBuffer, min.y - widthBuffer),\r\n \t\t\ttoPoint(max.x + heightBuffer, max.y + widthBuffer));\r\n \t},\r\n\r\n\r\n \t// @method equals(otherBounds: Bounds): Boolean\r\n \t// Returns `true` if the rectangle is equivalent to the given bounds.\r\n \tequals: function (bounds) {\r\n \t\tif (!bounds) { return false; }\r\n\r\n \t\tbounds = toBounds(bounds);\r\n\r\n \t\treturn this.min.equals(bounds.getTopLeft()) &&\r\n \t\t\tthis.max.equals(bounds.getBottomRight());\r\n \t},\r\n };\r\n\r\n\r\n // @factory L.bounds(corner1: Point, corner2: Point)\r\n // Creates a Bounds object from two corners coordinate pairs.\r\n // @alternative\r\n // @factory L.bounds(points: Point[])\r\n // Creates a Bounds object from the given array of points.\r\n function toBounds(a, b) {\r\n \tif (!a || a instanceof Bounds) {\r\n \t\treturn a;\r\n \t}\r\n \treturn new Bounds(a, b);\r\n }\n\n /*\r\n * @class LatLngBounds\r\n * @aka L.LatLngBounds\r\n *\r\n * Represents a rectangular geographical area on a map.\r\n *\r\n * @example\r\n *\r\n * ```js\r\n * var corner1 = L.latLng(40.712, -74.227),\r\n * corner2 = L.latLng(40.774, -74.125),\r\n * bounds = L.latLngBounds(corner1, corner2);\r\n * ```\r\n *\r\n * All Leaflet methods that accept LatLngBounds objects also accept them in a simple Array form (unless noted otherwise), so the bounds example above can be passed like this:\r\n *\r\n * ```js\r\n * map.fitBounds([\r\n * \t[40.712, -74.227],\r\n * \t[40.774, -74.125]\r\n * ]);\r\n * ```\r\n *\r\n * Caution: if the area crosses the antimeridian (often confused with the International Date Line), you must specify corners _outside_ the [-180, 180] degrees longitude range.\r\n *\r\n * Note that `LatLngBounds` does not inherit from Leaflet's `Class` object,\r\n * which means new classes can't inherit from it, and new methods\r\n * can't be added to it with the `include` function.\r\n */\r\n\r\n function LatLngBounds(corner1, corner2) { // (LatLng, LatLng) or (LatLng[])\r\n \tif (!corner1) { return; }\r\n\r\n \tvar latlngs = corner2 ? [corner1, corner2] : corner1;\r\n\r\n \tfor (var i = 0, len = latlngs.length; i < len; i++) {\r\n \t\tthis.extend(latlngs[i]);\r\n \t}\r\n }\r\n\r\n LatLngBounds.prototype = {\r\n\r\n \t// @method extend(latlng: LatLng): this\r\n \t// Extend the bounds to contain the given point\r\n\r\n \t// @alternative\r\n \t// @method extend(otherBounds: LatLngBounds): this\r\n \t// Extend the bounds to contain the given bounds\r\n \textend: function (obj) {\r\n \t\tvar sw = this._southWest,\r\n \t\t ne = this._northEast,\r\n \t\t sw2, ne2;\r\n\r\n \t\tif (obj instanceof LatLng) {\r\n \t\t\tsw2 = obj;\r\n \t\t\tne2 = obj;\r\n\r\n \t\t} else if (obj instanceof LatLngBounds) {\r\n \t\t\tsw2 = obj._southWest;\r\n \t\t\tne2 = obj._northEast;\r\n\r\n \t\t\tif (!sw2 || !ne2) { return this; }\r\n\r\n \t\t} else {\r\n \t\t\treturn obj ? this.extend(toLatLng(obj) || toLatLngBounds(obj)) : this;\r\n \t\t}\r\n\r\n \t\tif (!sw && !ne) {\r\n \t\t\tthis._southWest = new LatLng(sw2.lat, sw2.lng);\r\n \t\t\tthis._northEast = new LatLng(ne2.lat, ne2.lng);\r\n \t\t} else {\r\n \t\t\tsw.lat = Math.min(sw2.lat, sw.lat);\r\n \t\t\tsw.lng = Math.min(sw2.lng, sw.lng);\r\n \t\t\tne.lat = Math.max(ne2.lat, ne.lat);\r\n \t\t\tne.lng = Math.max(ne2.lng, ne.lng);\r\n \t\t}\r\n\r\n \t\treturn this;\r\n \t},\r\n\r\n \t// @method pad(bufferRatio: Number): LatLngBounds\r\n \t// Returns bounds created by extending or retracting the current bounds by a given ratio in each direction.\r\n \t// For example, a ratio of 0.5 extends the bounds by 50% in each direction.\r\n \t// Negative values will retract the bounds.\r\n \tpad: function (bufferRatio) {\r\n \t\tvar sw = this._southWest,\r\n \t\t ne = this._northEast,\r\n \t\t heightBuffer = Math.abs(sw.lat - ne.lat) * bufferRatio,\r\n \t\t widthBuffer = Math.abs(sw.lng - ne.lng) * bufferRatio;\r\n\r\n \t\treturn new LatLngBounds(\r\n \t\t new LatLng(sw.lat - heightBuffer, sw.lng - widthBuffer),\r\n \t\t new LatLng(ne.lat + heightBuffer, ne.lng + widthBuffer));\r\n \t},\r\n\r\n \t// @method getCenter(): LatLng\r\n \t// Returns the center point of the bounds.\r\n \tgetCenter: function () {\r\n \t\treturn new LatLng(\r\n \t\t (this._southWest.lat + this._northEast.lat) / 2,\r\n \t\t (this._southWest.lng + this._northEast.lng) / 2);\r\n \t},\r\n\r\n \t// @method getSouthWest(): LatLng\r\n \t// Returns the south-west point of the bounds.\r\n \tgetSouthWest: function () {\r\n \t\treturn this._southWest;\r\n \t},\r\n\r\n \t// @method getNorthEast(): LatLng\r\n \t// Returns the north-east point of the bounds.\r\n \tgetNorthEast: function () {\r\n \t\treturn this._northEast;\r\n \t},\r\n\r\n \t// @method getNorthWest(): LatLng\r\n \t// Returns the north-west point of the bounds.\r\n \tgetNorthWest: function () {\r\n \t\treturn new LatLng(this.getNorth(), this.getWest());\r\n \t},\r\n\r\n \t// @method getSouthEast(): LatLng\r\n \t// Returns the south-east point of the bounds.\r\n \tgetSouthEast: function () {\r\n \t\treturn new LatLng(this.getSouth(), this.getEast());\r\n \t},\r\n\r\n \t// @method getWest(): Number\r\n \t// Returns the west longitude of the bounds\r\n \tgetWest: function () {\r\n \t\treturn this._southWest.lng;\r\n \t},\r\n\r\n \t// @method getSouth(): Number\r\n \t// Returns the south latitude of the bounds\r\n \tgetSouth: function () {\r\n \t\treturn this._southWest.lat;\r\n \t},\r\n\r\n \t// @method getEast(): Number\r\n \t// Returns the east longitude of the bounds\r\n \tgetEast: function () {\r\n \t\treturn this._northEast.lng;\r\n \t},\r\n\r\n \t// @method getNorth(): Number\r\n \t// Returns the north latitude of the bounds\r\n \tgetNorth: function () {\r\n \t\treturn this._northEast.lat;\r\n \t},\r\n\r\n \t// @method contains(otherBounds: LatLngBounds): Boolean\r\n \t// Returns `true` if the rectangle contains the given one.\r\n\r\n \t// @alternative\r\n \t// @method contains (latlng: LatLng): Boolean\r\n \t// Returns `true` if the rectangle contains the given point.\r\n \tcontains: function (obj) { // (LatLngBounds) or (LatLng) -> Boolean\r\n \t\tif (typeof obj[0] === 'number' || obj instanceof LatLng || 'lat' in obj) {\r\n \t\t\tobj = toLatLng(obj);\r\n \t\t} else {\r\n \t\t\tobj = toLatLngBounds(obj);\r\n \t\t}\r\n\r\n \t\tvar sw = this._southWest,\r\n \t\t ne = this._northEast,\r\n \t\t sw2, ne2;\r\n\r\n \t\tif (obj instanceof LatLngBounds) {\r\n \t\t\tsw2 = obj.getSouthWest();\r\n \t\t\tne2 = obj.getNorthEast();\r\n \t\t} else {\r\n \t\t\tsw2 = ne2 = obj;\r\n \t\t}\r\n\r\n \t\treturn (sw2.lat >= sw.lat) && (ne2.lat <= ne.lat) &&\r\n \t\t (sw2.lng >= sw.lng) && (ne2.lng <= ne.lng);\r\n \t},\r\n\r\n \t// @method intersects(otherBounds: LatLngBounds): Boolean\r\n \t// Returns `true` if the rectangle intersects the given bounds. Two bounds intersect if they have at least one point in common.\r\n \tintersects: function (bounds) {\r\n \t\tbounds = toLatLngBounds(bounds);\r\n\r\n \t\tvar sw = this._southWest,\r\n \t\t ne = this._northEast,\r\n \t\t sw2 = bounds.getSouthWest(),\r\n \t\t ne2 = bounds.getNorthEast(),\r\n\r\n \t\t latIntersects = (ne2.lat >= sw.lat) && (sw2.lat <= ne.lat),\r\n \t\t lngIntersects = (ne2.lng >= sw.lng) && (sw2.lng <= ne.lng);\r\n\r\n \t\treturn latIntersects && lngIntersects;\r\n \t},\r\n\r\n \t// @method overlaps(otherBounds: LatLngBounds): Boolean\r\n \t// Returns `true` if the rectangle overlaps the given bounds. Two bounds overlap if their intersection is an area.\r\n \toverlaps: function (bounds) {\r\n \t\tbounds = toLatLngBounds(bounds);\r\n\r\n \t\tvar sw = this._southWest,\r\n \t\t ne = this._northEast,\r\n \t\t sw2 = bounds.getSouthWest(),\r\n \t\t ne2 = bounds.getNorthEast(),\r\n\r\n \t\t latOverlaps = (ne2.lat > sw.lat) && (sw2.lat < ne.lat),\r\n \t\t lngOverlaps = (ne2.lng > sw.lng) && (sw2.lng < ne.lng);\r\n\r\n \t\treturn latOverlaps && lngOverlaps;\r\n \t},\r\n\r\n \t// @method toBBoxString(): String\r\n \t// Returns a string with bounding box coordinates in a 'southwest_lng,southwest_lat,northeast_lng,northeast_lat' format. Useful for sending requests to web services that return geo data.\r\n \ttoBBoxString: function () {\r\n \t\treturn [this.getWest(), this.getSouth(), this.getEast(), this.getNorth()].join(',');\r\n \t},\r\n\r\n \t// @method equals(otherBounds: LatLngBounds, maxMargin?: Number): Boolean\r\n \t// Returns `true` if the rectangle is equivalent (within a small margin of error) to the given bounds. The margin of error can be overridden by setting `maxMargin` to a small number.\r\n \tequals: function (bounds, maxMargin) {\r\n \t\tif (!bounds) { return false; }\r\n\r\n \t\tbounds = toLatLngBounds(bounds);\r\n\r\n \t\treturn this._southWest.equals(bounds.getSouthWest(), maxMargin) &&\r\n \t\t this._northEast.equals(bounds.getNorthEast(), maxMargin);\r\n \t},\r\n\r\n \t// @method isValid(): Boolean\r\n \t// Returns `true` if the bounds are properly initialized.\r\n \tisValid: function () {\r\n \t\treturn !!(this._southWest && this._northEast);\r\n \t}\r\n };\r\n\r\n // TODO International date line?\r\n\r\n // @factory L.latLngBounds(corner1: LatLng, corner2: LatLng)\r\n // Creates a `LatLngBounds` object by defining two diagonally opposite corners of the rectangle.\r\n\r\n // @alternative\r\n // @factory L.latLngBounds(latlngs: LatLng[])\r\n // Creates a `LatLngBounds` object defined by the geographical points it contains. Very useful for zooming the map to fit a particular set of locations with [`fitBounds`](#map-fitbounds).\r\n function toLatLngBounds(a, b) {\r\n \tif (a instanceof LatLngBounds) {\r\n \t\treturn a;\r\n \t}\r\n \treturn new LatLngBounds(a, b);\r\n }\n\n /* @class LatLng\r\n * @aka L.LatLng\r\n *\r\n * Represents a geographical point with a certain latitude and longitude.\r\n *\r\n * @example\r\n *\r\n * ```\r\n * var latlng = L.latLng(50.5, 30.5);\r\n * ```\r\n *\r\n * All Leaflet methods that accept LatLng objects also accept them in a simple Array form and simple object form (unless noted otherwise), so these lines are equivalent:\r\n *\r\n * ```\r\n * map.panTo([50, 30]);\r\n * map.panTo({lon: 30, lat: 50});\r\n * map.panTo({lat: 50, lng: 30});\r\n * map.panTo(L.latLng(50, 30));\r\n * ```\r\n *\r\n * Note that `LatLng` does not inherit from Leaflet's `Class` object,\r\n * which means new classes can't inherit from it, and new methods\r\n * can't be added to it with the `include` function.\r\n */\r\n\r\n function LatLng(lat, lng, alt) {\r\n \tif (isNaN(lat) || isNaN(lng)) {\r\n \t\tthrow new Error('Invalid LatLng object: (' + lat + ', ' + lng + ')');\r\n \t}\r\n\r\n \t// @property lat: Number\r\n \t// Latitude in degrees\r\n \tthis.lat = +lat;\r\n\r\n \t// @property lng: Number\r\n \t// Longitude in degrees\r\n \tthis.lng = +lng;\r\n\r\n \t// @property alt: Number\r\n \t// Altitude in meters (optional)\r\n \tif (alt !== undefined) {\r\n \t\tthis.alt = +alt;\r\n \t}\r\n }\r\n\r\n LatLng.prototype = {\r\n \t// @method equals(otherLatLng: LatLng, maxMargin?: Number): Boolean\r\n \t// Returns `true` if the given `LatLng` point is at the same position (within a small margin of error). The margin of error can be overridden by setting `maxMargin` to a small number.\r\n \tequals: function (obj, maxMargin) {\r\n \t\tif (!obj) { return false; }\r\n\r\n \t\tobj = toLatLng(obj);\r\n\r\n \t\tvar margin = Math.max(\r\n \t\t Math.abs(this.lat - obj.lat),\r\n \t\t Math.abs(this.lng - obj.lng));\r\n\r\n \t\treturn margin <= (maxMargin === undefined ? 1.0E-9 : maxMargin);\r\n \t},\r\n\r\n \t// @method toString(): String\r\n \t// Returns a string representation of the point (for debugging purposes).\r\n \ttoString: function (precision) {\r\n \t\treturn 'LatLng(' +\r\n \t\t formatNum(this.lat, precision) + ', ' +\r\n \t\t formatNum(this.lng, precision) + ')';\r\n \t},\r\n\r\n \t// @method distanceTo(otherLatLng: LatLng): Number\r\n \t// Returns the distance (in meters) to the given `LatLng` calculated using the [Spherical Law of Cosines](https://en.wikipedia.org/wiki/Spherical_law_of_cosines).\r\n \tdistanceTo: function (other) {\r\n \t\treturn Earth.distance(this, toLatLng(other));\r\n \t},\r\n\r\n \t// @method wrap(): LatLng\r\n \t// Returns a new `LatLng` object with the longitude wrapped so it's always between -180 and +180 degrees.\r\n \twrap: function () {\r\n \t\treturn Earth.wrapLatLng(this);\r\n \t},\r\n\r\n \t// @method toBounds(sizeInMeters: Number): LatLngBounds\r\n \t// Returns a new `LatLngBounds` object in which each boundary is `sizeInMeters/2` meters apart from the `LatLng`.\r\n \ttoBounds: function (sizeInMeters) {\r\n \t\tvar latAccuracy = 180 * sizeInMeters / 40075017,\r\n \t\t lngAccuracy = latAccuracy / Math.cos((Math.PI / 180) * this.lat);\r\n\r\n \t\treturn toLatLngBounds(\r\n \t\t [this.lat - latAccuracy, this.lng - lngAccuracy],\r\n \t\t [this.lat + latAccuracy, this.lng + lngAccuracy]);\r\n \t},\r\n\r\n \tclone: function () {\r\n \t\treturn new LatLng(this.lat, this.lng, this.alt);\r\n \t}\r\n };\r\n\r\n\r\n\r\n // @factory L.latLng(latitude: Number, longitude: Number, altitude?: Number): LatLng\r\n // Creates an object representing a geographical point with the given latitude and longitude (and optionally altitude).\r\n\r\n // @alternative\r\n // @factory L.latLng(coords: Array): LatLng\r\n // Expects an array of the form `[Number, Number]` or `[Number, Number, Number]` instead.\r\n\r\n // @alternative\r\n // @factory L.latLng(coords: Object): LatLng\r\n // Expects an plain object of the form `{lat: Number, lng: Number}` or `{lat: Number, lng: Number, alt: Number}` instead.\r\n\r\n function toLatLng(a, b, c) {\r\n \tif (a instanceof LatLng) {\r\n \t\treturn a;\r\n \t}\r\n \tif (isArray(a) && typeof a[0] !== 'object') {\r\n \t\tif (a.length === 3) {\r\n \t\t\treturn new LatLng(a[0], a[1], a[2]);\r\n \t\t}\r\n \t\tif (a.length === 2) {\r\n \t\t\treturn new LatLng(a[0], a[1]);\r\n \t\t}\r\n \t\treturn null;\r\n \t}\r\n \tif (a === undefined || a === null) {\r\n \t\treturn a;\r\n \t}\r\n \tif (typeof a === 'object' && 'lat' in a) {\r\n \t\treturn new LatLng(a.lat, 'lng' in a ? a.lng : a.lon, a.alt);\r\n \t}\r\n \tif (b === undefined) {\r\n \t\treturn null;\r\n \t}\r\n \treturn new LatLng(a, b, c);\r\n }\n\n /*\r\n * @namespace CRS\r\n * @crs L.CRS.Base\r\n * Object that defines coordinate reference systems for projecting\r\n * geographical points into pixel (screen) coordinates and back (and to\r\n * coordinates in other units for [WMS](https://en.wikipedia.org/wiki/Web_Map_Service) services). See\r\n * [spatial reference system](https://en.wikipedia.org/wiki/Spatial_reference_system).\r\n *\r\n * Leaflet defines the most usual CRSs by default. If you want to use a\r\n * CRS not defined by default, take a look at the\r\n * [Proj4Leaflet](https://github.com/kartena/Proj4Leaflet) plugin.\r\n *\r\n * Note that the CRS instances do not inherit from Leaflet's `Class` object,\r\n * and can't be instantiated. Also, new classes can't inherit from them,\r\n * and methods can't be added to them with the `include` function.\r\n */\r\n\r\n var CRS = {\r\n \t// @method latLngToPoint(latlng: LatLng, zoom: Number): Point\r\n \t// Projects geographical coordinates into pixel coordinates for a given zoom.\r\n \tlatLngToPoint: function (latlng, zoom) {\r\n \t\tvar projectedPoint = this.projection.project(latlng),\r\n \t\t scale = this.scale(zoom);\r\n\r\n \t\treturn this.transformation._transform(projectedPoint, scale);\r\n \t},\r\n\r\n \t// @method pointToLatLng(point: Point, zoom: Number): LatLng\r\n \t// The inverse of `latLngToPoint`. Projects pixel coordinates on a given\r\n \t// zoom into geographical coordinates.\r\n \tpointToLatLng: function (point, zoom) {\r\n \t\tvar scale = this.scale(zoom),\r\n \t\t untransformedPoint = this.transformation.untransform(point, scale);\r\n\r\n \t\treturn this.projection.unproject(untransformedPoint);\r\n \t},\r\n\r\n \t// @method project(latlng: LatLng): Point\r\n \t// Projects geographical coordinates into coordinates in units accepted for\r\n \t// this CRS (e.g. meters for EPSG:3857, for passing it to WMS services).\r\n \tproject: function (latlng) {\r\n \t\treturn this.projection.project(latlng);\r\n \t},\r\n\r\n \t// @method unproject(point: Point): LatLng\r\n \t// Given a projected coordinate returns the corresponding LatLng.\r\n \t// The inverse of `project`.\r\n \tunproject: function (point) {\r\n \t\treturn this.projection.unproject(point);\r\n \t},\r\n\r\n \t// @method scale(zoom: Number): Number\r\n \t// Returns the scale used when transforming projected coordinates into\r\n \t// pixel coordinates for a particular zoom. For example, it returns\r\n \t// `256 * 2^zoom` for Mercator-based CRS.\r\n \tscale: function (zoom) {\r\n \t\treturn 256 * Math.pow(2, zoom);\r\n \t},\r\n\r\n \t// @method zoom(scale: Number): Number\r\n \t// Inverse of `scale()`, returns the zoom level corresponding to a scale\r\n \t// factor of `scale`.\r\n \tzoom: function (scale) {\r\n \t\treturn Math.log(scale / 256) / Math.LN2;\r\n \t},\r\n\r\n \t// @method getProjectedBounds(zoom: Number): Bounds\r\n \t// Returns the projection's bounds scaled and transformed for the provided `zoom`.\r\n \tgetProjectedBounds: function (zoom) {\r\n \t\tif (this.infinite) { return null; }\r\n\r\n \t\tvar b = this.projection.bounds,\r\n \t\t s = this.scale(zoom),\r\n \t\t min = this.transformation.transform(b.min, s),\r\n \t\t max = this.transformation.transform(b.max, s);\r\n\r\n \t\treturn new Bounds(min, max);\r\n \t},\r\n\r\n \t// @method distance(latlng1: LatLng, latlng2: LatLng): Number\r\n \t// Returns the distance between two geographical coordinates.\r\n\r\n \t// @property code: String\r\n \t// Standard code name of the CRS passed into WMS services (e.g. `'EPSG:3857'`)\r\n \t//\r\n \t// @property wrapLng: Number[]\r\n \t// An array of two numbers defining whether the longitude (horizontal) coordinate\r\n \t// axis wraps around a given range and how. Defaults to `[-180, 180]` in most\r\n \t// geographical CRSs. If `undefined`, the longitude axis does not wrap around.\r\n \t//\r\n \t// @property wrapLat: Number[]\r\n \t// Like `wrapLng`, but for the latitude (vertical) axis.\r\n\r\n \t// wrapLng: [min, max],\r\n \t// wrapLat: [min, max],\r\n\r\n \t// @property infinite: Boolean\r\n \t// If true, the coordinate space will be unbounded (infinite in both axes)\r\n \tinfinite: false,\r\n\r\n \t// @method wrapLatLng(latlng: LatLng): LatLng\r\n \t// Returns a `LatLng` where lat and lng has been wrapped according to the\r\n \t// CRS's `wrapLat` and `wrapLng` properties, if they are outside the CRS's bounds.\r\n \twrapLatLng: function (latlng) {\r\n \t\tvar lng = this.wrapLng ? wrapNum(latlng.lng, this.wrapLng, true) : latlng.lng,\r\n \t\t lat = this.wrapLat ? wrapNum(latlng.lat, this.wrapLat, true) : latlng.lat,\r\n \t\t alt = latlng.alt;\r\n\r\n \t\treturn new LatLng(lat, lng, alt);\r\n \t},\r\n\r\n \t// @method wrapLatLngBounds(bounds: LatLngBounds): LatLngBounds\r\n \t// Returns a `LatLngBounds` with the same size as the given one, ensuring\r\n \t// that its center is within the CRS's bounds.\r\n \t// Only accepts actual `L.LatLngBounds` instances, not arrays.\r\n \twrapLatLngBounds: function (bounds) {\r\n \t\tvar center = bounds.getCenter(),\r\n \t\t newCenter = this.wrapLatLng(center),\r\n \t\t latShift = center.lat - newCenter.lat,\r\n \t\t lngShift = center.lng - newCenter.lng;\r\n\r\n \t\tif (latShift === 0 && lngShift === 0) {\r\n \t\t\treturn bounds;\r\n \t\t}\r\n\r\n \t\tvar sw = bounds.getSouthWest(),\r\n \t\t ne = bounds.getNorthEast(),\r\n \t\t newSw = new LatLng(sw.lat - latShift, sw.lng - lngShift),\r\n \t\t newNe = new LatLng(ne.lat - latShift, ne.lng - lngShift);\r\n\r\n \t\treturn new LatLngBounds(newSw, newNe);\r\n \t}\r\n };\n\n /*\n * @namespace CRS\n * @crs L.CRS.Earth\n *\n * Serves as the base for CRS that are global such that they cover the earth.\n * Can only be used as the base for other CRS and cannot be used directly,\n * since it does not have a `code`, `projection` or `transformation`. `distance()` returns\n * meters.\n */\n\n var Earth = extend({}, CRS, {\n \twrapLng: [-180, 180],\n\n \t// Mean Earth Radius, as recommended for use by\n \t// the International Union of Geodesy and Geophysics,\n \t// see https://rosettacode.org/wiki/Haversine_formula\n \tR: 6371000,\n\n \t// distance between two geographical points using spherical law of cosines approximation\n \tdistance: function (latlng1, latlng2) {\n \t\tvar rad = Math.PI / 180,\n \t\t lat1 = latlng1.lat * rad,\n \t\t lat2 = latlng2.lat * rad,\n \t\t sinDLat = Math.sin((latlng2.lat - latlng1.lat) * rad / 2),\n \t\t sinDLon = Math.sin((latlng2.lng - latlng1.lng) * rad / 2),\n \t\t a = sinDLat * sinDLat + Math.cos(lat1) * Math.cos(lat2) * sinDLon * sinDLon,\n \t\t c = 2 * Math.atan2(Math.sqrt(a), Math.sqrt(1 - a));\n \t\treturn this.R * c;\n \t}\n });\n\n /*\r\n * @namespace Projection\r\n * @projection L.Projection.SphericalMercator\r\n *\r\n * Spherical Mercator projection — the most common projection for online maps,\r\n * used by almost all free and commercial tile providers. Assumes that Earth is\r\n * a sphere. Used by the `EPSG:3857` CRS.\r\n */\r\n\r\n var earthRadius = 6378137;\r\n\r\n var SphericalMercator = {\r\n\r\n \tR: earthRadius,\r\n \tMAX_LATITUDE: 85.0511287798,\r\n\r\n \tproject: function (latlng) {\r\n \t\tvar d = Math.PI / 180,\r\n \t\t max = this.MAX_LATITUDE,\r\n \t\t lat = Math.max(Math.min(max, latlng.lat), -max),\r\n \t\t sin = Math.sin(lat * d);\r\n\r\n \t\treturn new Point(\r\n \t\t\tthis.R * latlng.lng * d,\r\n \t\t\tthis.R * Math.log((1 + sin) / (1 - sin)) / 2);\r\n \t},\r\n\r\n \tunproject: function (point) {\r\n \t\tvar d = 180 / Math.PI;\r\n\r\n \t\treturn new LatLng(\r\n \t\t\t(2 * Math.atan(Math.exp(point.y / this.R)) - (Math.PI / 2)) * d,\r\n \t\t\tpoint.x * d / this.R);\r\n \t},\r\n\r\n \tbounds: (function () {\r\n \t\tvar d = earthRadius * Math.PI;\r\n \t\treturn new Bounds([-d, -d], [d, d]);\r\n \t})()\r\n };\n\n /*\r\n * @class Transformation\r\n * @aka L.Transformation\r\n *\r\n * Represents an affine transformation: a set of coefficients `a`, `b`, `c`, `d`\r\n * for transforming a point of a form `(x, y)` into `(a*x + b, c*y + d)` and doing\r\n * the reverse. Used by Leaflet in its projections code.\r\n *\r\n * @example\r\n *\r\n * ```js\r\n * var transformation = L.transformation(2, 5, -1, 10),\r\n * \tp = L.point(1, 2),\r\n * \tp2 = transformation.transform(p), // L.point(7, 8)\r\n * \tp3 = transformation.untransform(p2); // L.point(1, 2)\r\n * ```\r\n */\r\n\r\n\r\n // factory new L.Transformation(a: Number, b: Number, c: Number, d: Number)\r\n // Creates a `Transformation` object with the given coefficients.\r\n function Transformation(a, b, c, d) {\r\n \tif (isArray(a)) {\r\n \t\t// use array properties\r\n \t\tthis._a = a[0];\r\n \t\tthis._b = a[1];\r\n \t\tthis._c = a[2];\r\n \t\tthis._d = a[3];\r\n \t\treturn;\r\n \t}\r\n \tthis._a = a;\r\n \tthis._b = b;\r\n \tthis._c = c;\r\n \tthis._d = d;\r\n }\r\n\r\n Transformation.prototype = {\r\n \t// @method transform(point: Point, scale?: Number): Point\r\n \t// Returns a transformed point, optionally multiplied by the given scale.\r\n \t// Only accepts actual `L.Point` instances, not arrays.\r\n \ttransform: function (point, scale) { // (Point, Number) -> Point\r\n \t\treturn this._transform(point.clone(), scale);\r\n \t},\r\n\r\n \t// destructive transform (faster)\r\n \t_transform: function (point, scale) {\r\n \t\tscale = scale || 1;\r\n \t\tpoint.x = scale * (this._a * point.x + this._b);\r\n \t\tpoint.y = scale * (this._c * point.y + this._d);\r\n \t\treturn point;\r\n \t},\r\n\r\n \t// @method untransform(point: Point, scale?: Number): Point\r\n \t// Returns the reverse transformation of the given point, optionally divided\r\n \t// by the given scale. Only accepts actual `L.Point` instances, not arrays.\r\n \tuntransform: function (point, scale) {\r\n \t\tscale = scale || 1;\r\n \t\treturn new Point(\r\n \t\t (point.x / scale - this._b) / this._a,\r\n \t\t (point.y / scale - this._d) / this._c);\r\n \t}\r\n };\r\n\r\n // factory L.transformation(a: Number, b: Number, c: Number, d: Number)\r\n\r\n // @factory L.transformation(a: Number, b: Number, c: Number, d: Number)\r\n // Instantiates a Transformation object with the given coefficients.\r\n\r\n // @alternative\r\n // @factory L.transformation(coefficients: Array): Transformation\r\n // Expects an coefficients array of the form\r\n // `[a: Number, b: Number, c: Number, d: Number]`.\r\n\r\n function toTransformation(a, b, c, d) {\r\n \treturn new Transformation(a, b, c, d);\r\n }\n\n /*\r\n * @namespace CRS\r\n * @crs L.CRS.EPSG3857\r\n *\r\n * The most common CRS for online maps, used by almost all free and commercial\r\n * tile providers. Uses Spherical Mercator projection. Set in by default in\r\n * Map's `crs` option.\r\n */\r\n\r\n var EPSG3857 = extend({}, Earth, {\r\n \tcode: 'EPSG:3857',\r\n \tprojection: SphericalMercator,\r\n\r\n \ttransformation: (function () {\r\n \t\tvar scale = 0.5 / (Math.PI * SphericalMercator.R);\r\n \t\treturn toTransformation(scale, 0.5, -scale, 0.5);\r\n \t}())\r\n });\r\n\r\n var EPSG900913 = extend({}, EPSG3857, {\r\n \tcode: 'EPSG:900913'\r\n });\n\n // @namespace SVG; @section\n // There are several static functions which can be called without instantiating L.SVG:\n\n // @function create(name: String): SVGElement\n // Returns a instance of [SVGElement](https://developer.mozilla.org/docs/Web/API/SVGElement),\n // corresponding to the class name passed. For example, using 'line' will return\n // an instance of [SVGLineElement](https://developer.mozilla.org/docs/Web/API/SVGLineElement).\n function svgCreate(name) {\n \treturn document.createElementNS('http://www.w3.org/2000/svg', name);\n }\n\n // @function pointsToPath(rings: Point[], closed: Boolean): String\n // Generates a SVG path string for multiple rings, with each ring turning\n // into \"M..L..L..\" instructions\n function pointsToPath(rings, closed) {\n \tvar str = '',\n \ti, j, len, len2, points, p;\n\n \tfor (i = 0, len = rings.length; i < len; i++) {\n \t\tpoints = rings[i];\n\n \t\tfor (j = 0, len2 = points.length; j < len2; j++) {\n \t\t\tp = points[j];\n \t\t\tstr += (j ? 'L' : 'M') + p.x + ' ' + p.y;\n \t\t}\n\n \t\t// closes the ring for polygons; \"x\" is VML syntax\n \t\tstr += closed ? (Browser.svg ? 'z' : 'x') : '';\n \t}\n\n \t// SVG complains about empty path strings\n \treturn str || 'M0 0';\n }\n\n /*\r\n * @namespace Browser\r\n * @aka L.Browser\r\n *\r\n * A namespace with static properties for browser/feature detection used by Leaflet internally.\r\n *\r\n * @example\r\n *\r\n * ```js\r\n * if (L.Browser.ielt9) {\r\n * alert('Upgrade your browser, dude!');\r\n * }\r\n * ```\r\n */\r\n\r\n var style = document.documentElement.style;\r\n\r\n // @property ie: Boolean; `true` for all Internet Explorer versions (not Edge).\r\n var ie = 'ActiveXObject' in window;\r\n\r\n // @property ielt9: Boolean; `true` for Internet Explorer versions less than 9.\r\n var ielt9 = ie && !document.addEventListener;\r\n\r\n // @property edge: Boolean; `true` for the Edge web browser.\r\n var edge = 'msLaunchUri' in navigator && !('documentMode' in document);\r\n\r\n // @property webkit: Boolean;\r\n // `true` for webkit-based browsers like Chrome and Safari (including mobile versions).\r\n var webkit = userAgentContains('webkit');\r\n\r\n // @property android: Boolean\r\n // **Deprecated.** `true` for any browser running on an Android platform.\r\n var android = userAgentContains('android');\r\n\r\n // @property android23: Boolean; **Deprecated.** `true` for browsers running on Android 2 or Android 3.\r\n var android23 = userAgentContains('android 2') || userAgentContains('android 3');\r\n\r\n /* See https://stackoverflow.com/a/17961266 for details on detecting stock Android */\r\n var webkitVer = parseInt(/WebKit\\/([0-9]+)|$/.exec(navigator.userAgent)[1], 10); // also matches AppleWebKit\r\n // @property androidStock: Boolean; **Deprecated.** `true` for the Android stock browser (i.e. not Chrome)\r\n var androidStock = android && userAgentContains('Google') && webkitVer < 537 && !('AudioNode' in window);\r\n\r\n // @property opera: Boolean; `true` for the Opera browser\r\n var opera = !!window.opera;\r\n\r\n // @property chrome: Boolean; `true` for the Chrome browser.\r\n var chrome = !edge && userAgentContains('chrome');\r\n\r\n // @property gecko: Boolean; `true` for gecko-based browsers like Firefox.\r\n var gecko = userAgentContains('gecko') && !webkit && !opera && !ie;\r\n\r\n // @property safari: Boolean; `true` for the Safari browser.\r\n var safari = !chrome && userAgentContains('safari');\r\n\r\n var phantom = userAgentContains('phantom');\r\n\r\n // @property opera12: Boolean\r\n // `true` for the Opera browser supporting CSS transforms (version 12 or later).\r\n var opera12 = 'OTransition' in style;\r\n\r\n // @property win: Boolean; `true` when the browser is running in a Windows platform\r\n var win = navigator.platform.indexOf('Win') === 0;\r\n\r\n // @property ie3d: Boolean; `true` for all Internet Explorer versions supporting CSS transforms.\r\n var ie3d = ie && ('transition' in style);\r\n\r\n // @property webkit3d: Boolean; `true` for webkit-based browsers supporting CSS transforms.\r\n var webkit3d = ('WebKitCSSMatrix' in window) && ('m11' in new window.WebKitCSSMatrix()) && !android23;\r\n\r\n // @property gecko3d: Boolean; `true` for gecko-based browsers supporting CSS transforms.\r\n var gecko3d = 'MozPerspective' in style;\r\n\r\n // @property any3d: Boolean\r\n // `true` for all browsers supporting CSS transforms.\r\n var any3d = !window.L_DISABLE_3D && (ie3d || webkit3d || gecko3d) && !opera12 && !phantom;\r\n\r\n // @property mobile: Boolean; `true` for all browsers running in a mobile device.\r\n var mobile = typeof orientation !== 'undefined' || userAgentContains('mobile');\r\n\r\n // @property mobileWebkit: Boolean; `true` for all webkit-based browsers in a mobile device.\r\n var mobileWebkit = mobile && webkit;\r\n\r\n // @property mobileWebkit3d: Boolean\r\n // `true` for all webkit-based browsers in a mobile device supporting CSS transforms.\r\n var mobileWebkit3d = mobile && webkit3d;\r\n\r\n // @property msPointer: Boolean\r\n // `true` for browsers implementing the Microsoft touch events model (notably IE10).\r\n var msPointer = !window.PointerEvent && window.MSPointerEvent;\r\n\r\n // @property pointer: Boolean\r\n // `true` for all browsers supporting [pointer events](https://msdn.microsoft.com/en-us/library/dn433244%28v=vs.85%29.aspx).\r\n var pointer = !!(window.PointerEvent || msPointer);\r\n\r\n // @property touchNative: Boolean\r\n // `true` for all browsers supporting [touch events](https://developer.mozilla.org/docs/Web/API/Touch_events).\r\n // **This does not necessarily mean** that the browser is running in a computer with\r\n // a touchscreen, it only means that the browser is capable of understanding\r\n // touch events.\r\n var touchNative = 'ontouchstart' in window || !!window.TouchEvent;\r\n\r\n // @property touch: Boolean\r\n // `true` for all browsers supporting either [touch](#browser-touch) or [pointer](#browser-pointer) events.\r\n // Note: pointer events will be preferred (if available), and processed for all `touch*` listeners.\r\n var touch = !window.L_NO_TOUCH && (touchNative || pointer);\r\n\r\n // @property mobileOpera: Boolean; `true` for the Opera browser in a mobile device.\r\n var mobileOpera = mobile && opera;\r\n\r\n // @property mobileGecko: Boolean\r\n // `true` for gecko-based browsers running in a mobile device.\r\n var mobileGecko = mobile && gecko;\r\n\r\n // @property retina: Boolean\r\n // `true` for browsers on a high-resolution \"retina\" screen or on any screen when browser's display zoom is more than 100%.\r\n var retina = (window.devicePixelRatio || (window.screen.deviceXDPI / window.screen.logicalXDPI)) > 1;\r\n\r\n // @property passiveEvents: Boolean\r\n // `true` for browsers that support passive events.\r\n var passiveEvents = (function () {\r\n \tvar supportsPassiveOption = false;\r\n \ttry {\r\n \t\tvar opts = Object.defineProperty({}, 'passive', {\r\n \t\t\tget: function () { // eslint-disable-line getter-return\r\n \t\t\t\tsupportsPassiveOption = true;\r\n \t\t\t}\r\n \t\t});\r\n \t\twindow.addEventListener('testPassiveEventSupport', falseFn, opts);\r\n \t\twindow.removeEventListener('testPassiveEventSupport', falseFn, opts);\r\n \t} catch (e) {\r\n \t\t// Errors can safely be ignored since this is only a browser support test.\r\n \t}\r\n \treturn supportsPassiveOption;\r\n }());\r\n\r\n // @property canvas: Boolean\r\n // `true` when the browser supports [``](https://developer.mozilla.org/docs/Web/API/Canvas_API).\r\n var canvas$1 = (function () {\r\n \treturn !!document.createElement('canvas').getContext;\r\n }());\r\n\r\n // @property svg: Boolean\r\n // `true` when the browser supports [SVG](https://developer.mozilla.org/docs/Web/SVG).\r\n var svg$1 = !!(document.createElementNS && svgCreate('svg').createSVGRect);\r\n\r\n var inlineSvg = !!svg$1 && (function () {\r\n \tvar div = document.createElement('div');\r\n \tdiv.innerHTML = '';\r\n \treturn (div.firstChild && div.firstChild.namespaceURI) === 'http://www.w3.org/2000/svg';\r\n })();\r\n\r\n // @property vml: Boolean\r\n // `true` if the browser supports [VML](https://en.wikipedia.org/wiki/Vector_Markup_Language).\r\n var vml = !svg$1 && (function () {\r\n \ttry {\r\n \t\tvar div = document.createElement('div');\r\n \t\tdiv.innerHTML = '';\r\n\r\n \t\tvar shape = div.firstChild;\r\n \t\tshape.style.behavior = 'url(#default#VML)';\r\n\r\n \t\treturn shape && (typeof shape.adj === 'object');\r\n\r\n \t} catch (e) {\r\n \t\treturn false;\r\n \t}\r\n }());\r\n\r\n\r\n // @property mac: Boolean; `true` when the browser is running in a Mac platform\r\n var mac = navigator.platform.indexOf('Mac') === 0;\r\n\r\n // @property mac: Boolean; `true` when the browser is running in a Linux platform\r\n var linux = navigator.platform.indexOf('Linux') === 0;\r\n\r\n function userAgentContains(str) {\r\n \treturn navigator.userAgent.toLowerCase().indexOf(str) >= 0;\r\n }\r\n\r\n\r\n var Browser = {\r\n \tie: ie,\r\n \tielt9: ielt9,\r\n \tedge: edge,\r\n \twebkit: webkit,\r\n \tandroid: android,\r\n \tandroid23: android23,\r\n \tandroidStock: androidStock,\r\n \topera: opera,\r\n \tchrome: chrome,\r\n \tgecko: gecko,\r\n \tsafari: safari,\r\n \tphantom: phantom,\r\n \topera12: opera12,\r\n \twin: win,\r\n \tie3d: ie3d,\r\n \twebkit3d: webkit3d,\r\n \tgecko3d: gecko3d,\r\n \tany3d: any3d,\r\n \tmobile: mobile,\r\n \tmobileWebkit: mobileWebkit,\r\n \tmobileWebkit3d: mobileWebkit3d,\r\n \tmsPointer: msPointer,\r\n \tpointer: pointer,\r\n \ttouch: touch,\r\n \ttouchNative: touchNative,\r\n \tmobileOpera: mobileOpera,\r\n \tmobileGecko: mobileGecko,\r\n \tretina: retina,\r\n \tpassiveEvents: passiveEvents,\r\n \tcanvas: canvas$1,\r\n \tsvg: svg$1,\r\n \tvml: vml,\r\n \tinlineSvg: inlineSvg,\r\n \tmac: mac,\r\n \tlinux: linux\r\n };\n\n /*\n * Extends L.DomEvent to provide touch support for Internet Explorer and Windows-based devices.\n */\n\n var POINTER_DOWN = Browser.msPointer ? 'MSPointerDown' : 'pointerdown';\n var POINTER_MOVE = Browser.msPointer ? 'MSPointerMove' : 'pointermove';\n var POINTER_UP = Browser.msPointer ? 'MSPointerUp' : 'pointerup';\n var POINTER_CANCEL = Browser.msPointer ? 'MSPointerCancel' : 'pointercancel';\n var pEvent = {\n \ttouchstart : POINTER_DOWN,\n \ttouchmove : POINTER_MOVE,\n \ttouchend : POINTER_UP,\n \ttouchcancel : POINTER_CANCEL\n };\n var handle = {\n \ttouchstart : _onPointerStart,\n \ttouchmove : _handlePointer,\n \ttouchend : _handlePointer,\n \ttouchcancel : _handlePointer\n };\n var _pointers = {};\n var _pointerDocListener = false;\n\n // Provides a touch events wrapper for (ms)pointer events.\n // ref https://www.w3.org/TR/pointerevents/ https://www.w3.org/Bugs/Public/show_bug.cgi?id=22890\n\n function addPointerListener(obj, type, handler) {\n \tif (type === 'touchstart') {\n \t\t_addPointerDocListener();\n \t}\n \tif (!handle[type]) {\n \t\tconsole.warn('wrong event specified:', type);\n \t\treturn falseFn;\n \t}\n \thandler = handle[type].bind(this, handler);\n \tobj.addEventListener(pEvent[type], handler, false);\n \treturn handler;\n }\n\n function removePointerListener(obj, type, handler) {\n \tif (!pEvent[type]) {\n \t\tconsole.warn('wrong event specified:', type);\n \t\treturn;\n \t}\n \tobj.removeEventListener(pEvent[type], handler, false);\n }\n\n function _globalPointerDown(e) {\n \t_pointers[e.pointerId] = e;\n }\n\n function _globalPointerMove(e) {\n \tif (_pointers[e.pointerId]) {\n \t\t_pointers[e.pointerId] = e;\n \t}\n }\n\n function _globalPointerUp(e) {\n \tdelete _pointers[e.pointerId];\n }\n\n function _addPointerDocListener() {\n \t// need to keep track of what pointers and how many are active to provide e.touches emulation\n \tif (!_pointerDocListener) {\n \t\t// we listen document as any drags that end by moving the touch off the screen get fired there\n \t\tdocument.addEventListener(POINTER_DOWN, _globalPointerDown, true);\n \t\tdocument.addEventListener(POINTER_MOVE, _globalPointerMove, true);\n \t\tdocument.addEventListener(POINTER_UP, _globalPointerUp, true);\n \t\tdocument.addEventListener(POINTER_CANCEL, _globalPointerUp, true);\n\n \t\t_pointerDocListener = true;\n \t}\n }\n\n function _handlePointer(handler, e) {\n \tif (e.pointerType === (e.MSPOINTER_TYPE_MOUSE || 'mouse')) { return; }\n\n \te.touches = [];\n \tfor (var i in _pointers) {\n \t\te.touches.push(_pointers[i]);\n \t}\n \te.changedTouches = [e];\n\n \thandler(e);\n }\n\n function _onPointerStart(handler, e) {\n \t// IE10 specific: MsTouch needs preventDefault. See #2000\n \tif (e.MSPOINTER_TYPE_TOUCH && e.pointerType === e.MSPOINTER_TYPE_TOUCH) {\n \t\tpreventDefault(e);\n \t}\n \t_handlePointer(handler, e);\n }\n\n /*\r\n * Extends the event handling code with double tap support for mobile browsers.\r\n *\r\n * Note: currently most browsers fire native dblclick, with only a few exceptions\r\n * (see https://github.com/Leaflet/Leaflet/issues/7012#issuecomment-595087386)\r\n */\r\n\r\n function makeDblclick(event) {\r\n \t// in modern browsers `type` cannot be just overridden:\r\n \t// https://developer.mozilla.org/en-US/docs/Web/JavaScript/Reference/Errors/Getter_only\r\n \tvar newEvent = {},\r\n \t prop, i;\r\n \tfor (i in event) {\r\n \t\tprop = event[i];\r\n \t\tnewEvent[i] = prop && prop.bind ? prop.bind(event) : prop;\r\n \t}\r\n \tevent = newEvent;\r\n \tnewEvent.type = 'dblclick';\r\n \tnewEvent.detail = 2;\r\n \tnewEvent.isTrusted = false;\r\n \tnewEvent._simulated = true; // for debug purposes\r\n \treturn newEvent;\r\n }\r\n\r\n var delay = 200;\r\n function addDoubleTapListener(obj, handler) {\r\n \t// Most browsers handle double tap natively\r\n \tobj.addEventListener('dblclick', handler);\r\n\r\n \t// On some platforms the browser doesn't fire native dblclicks for touch events.\r\n \t// It seems that in all such cases `detail` property of `click` event is always `1`.\r\n \t// So here we rely on that fact to avoid excessive 'dblclick' simulation when not needed.\r\n \tvar last = 0,\r\n \t detail;\r\n \tfunction simDblclick(e) {\r\n \t\tif (e.detail !== 1) {\r\n \t\t\tdetail = e.detail; // keep in sync to avoid false dblclick in some cases\r\n \t\t\treturn;\r\n \t\t}\r\n\r\n \t\tif (e.pointerType === 'mouse' ||\r\n \t\t\t(e.sourceCapabilities && !e.sourceCapabilities.firesTouchEvents)) {\r\n\r\n \t\t\treturn;\r\n \t\t}\r\n\r\n \t\t// When clicking on an , the browser generates a click on its\r\n \t\t//